BLASTX nr result
ID: Ephedra27_contig00013440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00013440 (464 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN41196.1| unknown [Picea sitchensis] 103 2e-20 gb|ABK23241.1| unknown [Picea sitchensis] gi|224285601|gb|ACN405... 103 2e-20 ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-contai... 98 1e-18 dbj|BAJ87737.1| predicted protein [Hordeum vulgare subsp. vulgare] 96 4e-18 gb|EPS69948.1| hypothetical protein M569_04813 [Genlisea aurea] 96 6e-18 ref|XP_003568342.1| PREDICTED: pleckstrin homology domain-contai... 96 6e-18 ref|XP_002441190.1| hypothetical protein SORBIDRAFT_09g021960 [S... 95 8e-18 ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycin... 95 1e-17 ref|NP_001148629.1| pleckstrin homology domain-containing protei... 95 1e-17 gb|EEC79313.1| hypothetical protein OsI_20149 [Oryza sativa Indi... 94 1e-17 ref|NP_001055692.1| Os05g0447000 [Oryza sativa Japonica Group] g... 94 1e-17 ref|XP_006654485.1| PREDICTED: pleckstrin homology domain-contai... 94 2e-17 ref|NP_196190.1| pleckstrin homology domain-containing protein [... 94 2e-17 ref|XP_002871177.1| hypothetical protein ARALYDRAFT_487373 [Arab... 94 2e-17 gb|AAM61053.1| AtPH1-like protein [Arabidopsis thaliana] 94 2e-17 gb|EXB58195.1| Pleckstrin-like domain-containing protein 1 [Moru... 94 2e-17 ref|XP_002315163.2| pleckstrin homology domain-containing family... 94 2e-17 ref|XP_004961916.1| PREDICTED: pleckstrin homology domain-contai... 94 2e-17 gb|AGV54329.1| pleckstrin homology domain-containing protein [Ph... 93 3e-17 gb|EOY17841.1| Pleckstrin (PH) domain superfamily protein [Theob... 93 3e-17 >gb|ACN41196.1| unknown [Picea sitchensis] Length = 140 Score = 103 bits (258), Expect = 2e-20 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 VDFWNG ERSGWLMKQGEYIKTWRRRWFVLK+G+LFWFK++++TRDS PR Sbjct: 15 VDFWNGPERSGWLMKQGEYIKTWRRRWFVLKQGKLFWFKENYITRDSNPR 64 >gb|ABK23241.1| unknown [Picea sitchensis] gi|224285601|gb|ACN40519.1| unknown [Picea sitchensis] Length = 140 Score = 103 bits (258), Expect = 2e-20 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 VDFWNG ERSGWLMKQGEYIKTWRRRWFVLK+G+LFWFK++++TRDS PR Sbjct: 15 VDFWNGPERSGWLMKQGEYIKTWRRRWFVLKQGKLFWFKENYITRDSNPR 64 >ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] Length = 143 Score = 97.8 bits (242), Expect = 1e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 VDFW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFKDS+VT DS+PR Sbjct: 21 VDFWSTPERAGWLTKQGEYIKTWRRRWFVLKRGKLFWFKDSYVTHDSKPR 70 >dbj|BAJ87737.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 170 Score = 96.3 bits (238), Expect = 4e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+GAER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD+ VTR S PR Sbjct: 28 VEFWHGAERAGWLTKQGEYIKTWRRRWFVLKQGRLFWFKDAAVTRGSVPR 77 >gb|EPS69948.1| hypothetical protein M569_04813 [Genlisea aurea] Length = 144 Score = 95.5 bits (236), Expect = 6e-18 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW ERSGWL KQGEYIKTWRRRWFVLK+G+LFWFKDS VTR SRPR Sbjct: 22 VEFWGTPERSGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSAVTRSSRPR 71 >ref|XP_003568342.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Brachypodium distachyon] Length = 163 Score = 95.5 bits (236), Expect = 6e-18 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+GAER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD VTR S PR Sbjct: 25 VEFWHGAERAGWLTKQGEYIKTWRRRWFVLKQGRLFWFKDPVVTRASVPR 74 >ref|XP_002441190.1| hypothetical protein SORBIDRAFT_09g021960 [Sorghum bicolor] gi|241946475|gb|EES19620.1| hypothetical protein SORBIDRAFT_09g021960 [Sorghum bicolor] Length = 169 Score = 95.1 bits (235), Expect = 8e-18 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+GAER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD VTR S PR Sbjct: 31 VEFWHGAERAGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDPVVTRASVPR 80 >ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|571505514|ref|XP_006595539.1| PREDICTED: uncharacterized protein LOC100527890 isoform X1 [Glycine max] gi|571505517|ref|XP_006595540.1| PREDICTED: uncharacterized protein LOC100527890 isoform X2 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] Length = 146 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFKDS VTR SRPR Sbjct: 21 VEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSAVTRASRPR 70 >ref|NP_001148629.1| pleckstrin homology domain-containing protein 1 [Zea mays] gi|195620920|gb|ACG32290.1| pleckstrin homology domain-containing protein 1 [Zea mays] gi|413949066|gb|AFW81715.1| hypothetical protein ZEAMMB73_052557 [Zea mays] Length = 166 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+GAER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD VTR S PR Sbjct: 28 VEFWHGAERAGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDPAVTRASVPR 77 >gb|EEC79313.1| hypothetical protein OsI_20149 [Oryza sativa Indica Group] Length = 172 Score = 94.4 bits (233), Expect = 1e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+G ER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD+ VTR S PR Sbjct: 32 VEFWHGGERTGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDAAVTRGSVPR 81 >ref|NP_001055692.1| Os05g0447000 [Oryza sativa Japonica Group] gi|51854377|gb|AAU10757.1| unknown protein [Oryza sativa Japonica Group] gi|113579243|dbj|BAF17606.1| Os05g0447000 [Oryza sativa Japonica Group] Length = 172 Score = 94.4 bits (233), Expect = 1e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+G ER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD+ VTR S PR Sbjct: 32 VEFWHGGERTGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDAAVTRGSVPR 81 >ref|XP_006654485.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Oryza brachyantha] Length = 168 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+G ER+GWL KQGEYIKTWRRRWFVLK+GRLFWFKD+ VTR S PR Sbjct: 30 VEFWHGGERTGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDAAVTRASVPR 79 >ref|NP_196190.1| pleckstrin homology domain-containing protein [Arabidopsis thaliana] gi|9759096|dbj|BAB09665.1| AtPH1-like protein [Arabidopsis thaliana] gi|98960875|gb|ABF58921.1| At5g05710 [Arabidopsis thaliana] gi|110737775|dbj|BAF00826.1| AtPH1-like protein [Arabidopsis thaliana] gi|332003530|gb|AED90913.1| pleckstrin homology domain-containing protein [Arabidopsis thaliana] Length = 144 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFKDS VTR SRPR Sbjct: 22 VEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSDVTRVSRPR 71 >ref|XP_002871177.1| hypothetical protein ARALYDRAFT_487373 [Arabidopsis lyrata subsp. lyrata] gi|297317014|gb|EFH47436.1| hypothetical protein ARALYDRAFT_487373 [Arabidopsis lyrata subsp. lyrata] Length = 144 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFKDS VTR SRPR Sbjct: 22 VEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSDVTRVSRPR 71 >gb|AAM61053.1| AtPH1-like protein [Arabidopsis thaliana] Length = 144 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFKDS VTR SRPR Sbjct: 22 VEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSDVTRVSRPR 71 >gb|EXB58195.1| Pleckstrin-like domain-containing protein 1 [Morus notabilis] Length = 143 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER GWL KQGEYIKTWRRRWFVLK+G+LFWFKDS VTR SRPR Sbjct: 21 VEFWSTPERGGWLTKQGEYIKTWRRRWFVLKQGKLFWFKDSAVTRASRPR 70 >ref|XP_002315163.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] gi|550330185|gb|EEF01334.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] Length = 148 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWLMKQGE+IKTWRRRWFVLK+G+LFWFKDS VTR S+PR Sbjct: 22 VEFWSSPERTGWLMKQGEHIKTWRRRWFVLKQGKLFWFKDSTVTRVSKPR 71 >ref|XP_004961916.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Setaria italica] Length = 170 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+GAER GWL KQGEYIKTWRRRWFVLK+GRLFWFKD VTR S PR Sbjct: 32 VEFWHGAERVGWLNKQGEYIKTWRRRWFVLKQGRLFWFKDPAVTRASVPR 81 >gb|AGV54329.1| pleckstrin homology domain-containing protein [Phaseolus vulgaris] gi|561020759|gb|ESW19530.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] gi|561020760|gb|ESW19531.1| hypothetical protein PHAVU_006G132900g [Phaseolus vulgaris] Length = 146 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFK+S VTR SRPR Sbjct: 21 VEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKESAVTRASRPR 70 >gb|EOY17841.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] Length = 143 Score = 93.2 bits (230), Expect = 3e-17 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -1 Query: 152 VDFWNGAERSGWLMKQGEYIKTWRRRWFVLKKGRLFWFKDSFVTRDSRPR 3 V+FW+ ER+GWL KQGEYIKTWRRRWFVLK+G+LFWFK+S +TR SRPR Sbjct: 21 VEFWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKESTITRGSRPR 70