BLASTX nr result
ID: Ephedra27_contig00013413
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00013413 (566 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFN53663.1| cytochrome P450 [Linum usitatissimum] 57 2e-06 gb|EOY33774.1| Cytochrome P450, family 86, subfamily A, polypept... 57 4e-06 ref|XP_006425039.1| hypothetical protein CICLE_v10030097mg [Citr... 56 5e-06 ref|XP_004298810.1| PREDICTED: cytochrome P450 86A2-like [Fragar... 56 5e-06 gb|EMJ20192.1| hypothetical protein PRUPE_ppa004034mg [Prunus pe... 56 7e-06 dbj|BAJ88802.1| predicted protein [Hordeum vulgare subsp. vulgar... 56 7e-06 ref|XP_002525608.1| cytochrome P450, putative [Ricinus communis]... 56 7e-06 ref|XP_002314117.1| Cytochrome P450 86A1 family protein [Populus... 56 7e-06 ref|XP_006652635.1| PREDICTED: cytochrome P450 86A4-like [Oryza ... 55 9e-06 >gb|AFN53663.1| cytochrome P450 [Linum usitatissimum] Length = 516 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLSPY 107 LSL PGH+VEQKMSLTLFMK+GL+V++QPR LS Y Sbjct: 482 LSLEPGHRVEQKMSLTLFMKNGLRVMLQPRDLSSY 516 >gb|EOY33774.1| Cytochrome P450, family 86, subfamily A, polypeptide 1 [Theobroma cacao] Length = 511 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLS 101 LSLVPGH+VEQKMSLTLFMK GL+V +QPR+L+ Sbjct: 479 LSLVPGHRVEQKMSLTLFMKDGLRVYLQPRILA 511 >ref|XP_006425039.1| hypothetical protein CICLE_v10030097mg [Citrus clementina] gi|568870612|ref|XP_006488493.1| PREDICTED: cytochrome P450 86A1-like [Citrus sinensis] gi|557526973|gb|ESR38279.1| hypothetical protein CICLE_v10030097mg [Citrus clementina] Length = 513 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLS 101 LSLVPGH+VEQKMSLTLFMKHGL+V + PR L+ Sbjct: 479 LSLVPGHRVEQKMSLTLFMKHGLRVFLHPRNLA 511 >ref|XP_004298810.1| PREDICTED: cytochrome P450 86A2-like [Fragaria vesca subsp. vesca] Length = 543 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLSP 104 L++VPGH+VEQKMSLTLFMK+GL+V VQPR L P Sbjct: 482 LAVVPGHRVEQKMSLTLFMKYGLKVSVQPRDLKP 515 >gb|EMJ20192.1| hypothetical protein PRUPE_ppa004034mg [Prunus persica] Length = 534 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVL 98 L+LVPGHKVEQKMSLTLFMKHGL V V PR L Sbjct: 480 LTLVPGHKVEQKMSLTLFMKHGLMVNVHPREL 511 >dbj|BAJ88802.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326527943|dbj|BAJ89023.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532670|dbj|BAJ89180.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326534338|dbj|BAJ89519.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 530 Score = 55.8 bits (133), Expect = 7e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLSP 104 L++ PGH+VEQKMSLTLFMKHGL+++V+PR L+P Sbjct: 480 LAVAPGHRVEQKMSLTLFMKHGLRMVVRPRDLAP 513 >ref|XP_002525608.1| cytochrome P450, putative [Ricinus communis] gi|223535044|gb|EEF36726.1| cytochrome P450, putative [Ricinus communis] Length = 511 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLS 101 LSLVPGH+VEQKMSLTLFMK+GL+V + PR+L+ Sbjct: 479 LSLVPGHRVEQKMSLTLFMKNGLRVFLHPRILA 511 >ref|XP_002314117.1| Cytochrome P450 86A1 family protein [Populus trichocarpa] gi|118486379|gb|ABK95030.1| unknown [Populus trichocarpa] gi|222850525|gb|EEE88072.1| Cytochrome P450 86A1 family protein [Populus trichocarpa] Length = 511 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLS 101 LSLVPGH+VEQKMSLTLFMK+GL VL+ PR L+ Sbjct: 479 LSLVPGHRVEQKMSLTLFMKNGLHVLLHPRTLA 511 >ref|XP_006652635.1| PREDICTED: cytochrome P450 86A4-like [Oryza brachyantha] Length = 540 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 3 LSLVPGHKVEQKMSLTLFMKHGLQVLVQPRVLSP 104 LS+ PGH+VEQKMSLTLFMKHGL++ V+PR L+P Sbjct: 485 LSVAPGHRVEQKMSLTLFMKHGLRMEVRPRDLAP 518