BLASTX nr result
ID: Ephedra27_contig00013331
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00013331 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006858410.1| hypothetical protein AMTR_s00071p00045940 [A... 58 1e-06 >ref|XP_006858410.1| hypothetical protein AMTR_s00071p00045940 [Amborella trichopoda] gi|548862519|gb|ERN19877.1| hypothetical protein AMTR_s00071p00045940 [Amborella trichopoda] Length = 1080 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -3 Query: 325 LEVAVETIRSCLEKFSGFPKAQFDFLTFDSSLHCYNTK 212 LEVA +TI+SCL+K GFP+ Q FLTFDSSLH YN K Sbjct: 503 LEVAAKTIKSCLDKLPGFPRTQIGFLTFDSSLHFYNMK 540