BLASTX nr result
ID: Ephedra27_contig00012892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00012892 (454 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADE77104.1| unknown [Picea sitchensis] 74 3e-11 gb|AFG67020.1| hypothetical protein 0_9340_01, partial [Pinus ta... 73 4e-11 ref|XP_006854346.1| hypothetical protein AMTR_s00039p00148640 [A... 71 1e-10 ref|XP_003580101.1| PREDICTED: CLIP-associating protein 1-B-like... 68 1e-09 emb|CBI37243.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002265367.1| PREDICTED: CLIP-associating protein-like [Vi... 67 2e-09 emb|CAN66676.1| hypothetical protein VITISV_032909 [Vitis vinifera] 67 2e-09 gb|EMT04266.1| CLIP-associating protein 1 [Aegilops tauschii] 67 3e-09 ref|XP_006647520.1| PREDICTED: CLIP-associated protein-like [Ory... 66 4e-09 ref|XP_006299884.1| hypothetical protein CARUB_v10016091mg [Caps... 66 4e-09 gb|EEE61304.1| hypothetical protein OsJ_15396 [Oryza sativa Japo... 66 4e-09 gb|EEE57379.1| hypothetical protein OsJ_07538 [Oryza sativa Japo... 66 4e-09 gb|EEC73604.1| hypothetical protein OsI_08085 [Oryza sativa Indi... 66 4e-09 emb|CAE04721.2| OSJNBa0043L24.9 [Oryza sativa Japonica Group] gi... 66 4e-09 ref|XP_004240469.1| PREDICTED: uncharacterized protein LOC101260... 66 5e-09 ref|NP_849997.2| CLIP-associated protein [Arabidopsis thaliana] ... 66 5e-09 gb|AAD24379.1| unknown protein [Arabidopsis thaliana] 66 5e-09 ref|XP_006443676.1| hypothetical protein CICLE_v10018498mg [Citr... 65 7e-09 dbj|BAK08362.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 7e-09 ref|XP_006408933.1| hypothetical protein EUTSA_v10001879mg [Eutr... 65 9e-09 >gb|ADE77104.1| unknown [Picea sitchensis] Length = 227 Score = 73.6 bits (179), Expect = 3e-11 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YIVLGKAFLPYLG+LSSTQLRLVTIYANRIS+ARSGA VD Sbjct: 184 YIVLGKAFLPYLGSLSSTQLRLVTIYANRISQARSGASVD 223 >gb|AFG67020.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167976|gb|AFG67021.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167978|gb|AFG67022.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167980|gb|AFG67023.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167982|gb|AFG67024.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167984|gb|AFG67025.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167986|gb|AFG67026.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167988|gb|AFG67027.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167990|gb|AFG67028.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167992|gb|AFG67029.1| hypothetical protein 0_9340_01, partial [Pinus taeda] gi|383167994|gb|AFG67030.1| hypothetical protein 0_9340_01, partial [Pinus taeda] Length = 67 Score = 72.8 bits (177), Expect = 4e-11 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YIVLGKAFLPYLG+LSSTQLRLVTIYANRIS+ARSGA V+ Sbjct: 27 YIVLGKAFLPYLGSLSSTQLRLVTIYANRISQARSGATVE 66 >ref|XP_006854346.1| hypothetical protein AMTR_s00039p00148640 [Amborella trichopoda] gi|548858022|gb|ERN15813.1| hypothetical protein AMTR_s00039p00148640 [Amborella trichopoda] Length = 1463 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVDMESV 134 YIVLGKAFLPYLG LSSTQLRLVTIYANRIS+AR+G +D V Sbjct: 1420 YIVLGKAFLPYLGGLSSTQLRLVTIYANRISQARTGTAIDGNQV 1463 >ref|XP_003580101.1| PREDICTED: CLIP-associating protein 1-B-like [Brachypodium distachyon] Length = 1439 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVDME 128 YI+LGKAF+PYL LSSTQLRLVTIYANRIS+ARSGA +D + Sbjct: 1397 YIMLGKAFVPYLEGLSSTQLRLVTIYANRISQARSGAPIDAD 1438 >emb|CBI37243.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAFLPYL L+STQLRLVTIYANRIS+AR+GA +D Sbjct: 232 YIMLGKAFLPYLEGLNSTQLRLVTIYANRISQARTGATID 271 >ref|XP_002265367.1| PREDICTED: CLIP-associating protein-like [Vitis vinifera] Length = 1440 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAFLPYL L+STQLRLVTIYANRIS+AR+GA +D Sbjct: 1397 YIMLGKAFLPYLEGLNSTQLRLVTIYANRISQARTGATID 1436 >emb|CAN66676.1| hypothetical protein VITISV_032909 [Vitis vinifera] Length = 1135 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAFLPYL L+STQLRLVTIYANRIS+AR+GA +D Sbjct: 1092 YIMLGKAFLPYLEGLNSTQLRLVTIYANRISQARTGATID 1131 >gb|EMT04266.1| CLIP-associating protein 1 [Aegilops tauschii] Length = 1425 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL LSSTQLRLVTIYANRIS+ARSG +D Sbjct: 1382 YIMLGKAFVPYLEGLSSTQLRLVTIYANRISQARSGTAID 1421 >ref|XP_006647520.1| PREDICTED: CLIP-associated protein-like [Oryza brachyantha] Length = 1434 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL L+STQLRLVTIYANRIS+ARSGA +D Sbjct: 1392 YIMLGKAFVPYLEGLNSTQLRLVTIYANRISQARSGAPID 1431 >ref|XP_006299884.1| hypothetical protein CARUB_v10016091mg [Capsella rubella] gi|482568593|gb|EOA32782.1| hypothetical protein CARUB_v10016091mg [Capsella rubella] Length = 1439 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAFLPYL LSSTQ+RLVTIYANRIS+AR+GA +D Sbjct: 1397 YIMLGKAFLPYLEGLSSTQVRLVTIYANRISQARTGAPID 1436 >gb|EEE61304.1| hypothetical protein OsJ_15396 [Oryza sativa Japonica Group] Length = 1273 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL L+STQLRLVTIYANRIS+ARSGA +D Sbjct: 1231 YIMLGKAFVPYLEGLNSTQLRLVTIYANRISQARSGAPID 1270 >gb|EEE57379.1| hypothetical protein OsJ_07538 [Oryza sativa Japonica Group] Length = 1435 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL L+STQLRLVTIYANRIS+ARSGA +D Sbjct: 1393 YIMLGKAFVPYLEGLNSTQLRLVTIYANRISQARSGAPID 1432 >gb|EEC73604.1| hypothetical protein OsI_08085 [Oryza sativa Indica Group] Length = 1435 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL L+STQLRLVTIYANRIS+ARSGA +D Sbjct: 1393 YIMLGKAFVPYLEGLNSTQLRLVTIYANRISQARSGAPID 1432 >emb|CAE04721.2| OSJNBa0043L24.9 [Oryza sativa Japonica Group] gi|116310322|emb|CAH67338.1| OSIGBa0157A06.7 [Oryza sativa Indica Group] gi|218195174|gb|EEC77601.1| hypothetical protein OsI_16568 [Oryza sativa Indica Group] Length = 1443 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL L+STQLRLVTIYANRIS+ARSGA +D Sbjct: 1401 YIMLGKAFVPYLEGLNSTQLRLVTIYANRISQARSGAPID 1440 >ref|XP_004240469.1| PREDICTED: uncharacterized protein LOC101260646 [Solanum lycopersicum] Length = 1436 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAF+PYL L+STQLRLVTIYANRIS+AR+GA VD Sbjct: 1393 YIMLGKAFMPYLEGLNSTQLRLVTIYANRISQARTGAPVD 1432 >ref|NP_849997.2| CLIP-associated protein [Arabidopsis thaliana] gi|75247625|sp|Q8RWY6.1|CLASP_ARATH RecName: Full=CLIP-associated protein; Short=AtCLASP gi|20259452|gb|AAM13846.1| unknown protein [Arabidopsis thaliana] gi|330251886|gb|AEC06980.1| CLIP-associated protein [Arabidopsis thaliana] Length = 1439 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVDMES 131 YI+LGKAFLPYL L+STQ+RLVTIYANRIS+AR+GA +D ++ Sbjct: 1397 YIMLGKAFLPYLEGLNSTQVRLVTIYANRISQARNGAPIDADT 1439 >gb|AAD24379.1| unknown protein [Arabidopsis thaliana] Length = 351 Score = 65.9 bits (159), Expect = 5e-09 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVDMES 131 YI+LGKAFLPYL L+STQ+RLVTIYANRIS+AR+GA +D ++ Sbjct: 309 YIMLGKAFLPYLEGLNSTQVRLVTIYANRISQARNGAPIDADT 351 >ref|XP_006443676.1| hypothetical protein CICLE_v10018498mg [Citrus clementina] gi|568853044|ref|XP_006480177.1| PREDICTED: CLIP-associated protein-like [Citrus sinensis] gi|557545938|gb|ESR56916.1| hypothetical protein CICLE_v10018498mg [Citrus clementina] Length = 1418 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAFLPYL L+STQLRLVTIYANRIS+AR+G +D Sbjct: 1376 YIMLGKAFLPYLERLNSTQLRLVTIYANRISQARTGTTID 1415 >dbj|BAK08362.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 359 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGK+F+PYL LSSTQLRLVTIYANRIS+ARSG +D Sbjct: 317 YIMLGKSFVPYLEGLSSTQLRLVTIYANRISQARSGTAID 356 >ref|XP_006408933.1| hypothetical protein EUTSA_v10001879mg [Eutrema salsugineum] gi|557110089|gb|ESQ50386.1| hypothetical protein EUTSA_v10001879mg [Eutrema salsugineum] Length = 1439 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +3 Query: 3 YIVLGKAFLPYLGNLSSTQLRLVTIYANRISKARSGAVVD 122 YI+LGKAFLPYL L+STQ+RLVTIYANRIS+AR+GA +D Sbjct: 1397 YIMLGKAFLPYLEGLNSTQVRLVTIYANRISQARTGAPID 1436