BLASTX nr result
ID: Ephedra27_contig00012598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00012598 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ05718.1| hypothetical protein PRUPE_ppa018171mg [Prunus pe... 68 8e-17 ref|XP_004306988.1| PREDICTED: plasma membrane ATPase 1-like [Fr... 67 1e-16 gb|EXB37636.1| Plasma membrane ATPase 1 [Morus notabilis] 65 8e-16 ref|XP_002979990.1| hypothetical protein SELMODRAFT_419690 [Sela... 71 2e-10 ref|XP_002991931.1| hypothetical protein SELMODRAFT_430150 [Sela... 71 2e-10 ref|XP_002517457.1| H(\+)-transporting atpase plant/fungi plasma... 70 3e-10 ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersic... 69 6e-10 ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-l... 69 6e-10 ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [So... 69 6e-10 ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citr... 69 6e-10 gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plu... 69 6e-10 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis] 69 8e-10 ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [So... 69 8e-10 ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-l... 69 8e-10 ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-l... 69 8e-10 ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-l... 69 8e-10 gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia] 69 8e-10 ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersi... 69 8e-10 ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuber... 69 8e-10 sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; A... 68 1e-09 >gb|EMJ05718.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica] Length = 965 Score = 67.8 bits (164), Expect(2) = 8e-17 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L +FGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LDLFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 44.7 bits (104), Expect(2) = 8e-17 Identities = 22/32 (68%), Positives = 26/32 (81%), Gaps = 2/32 (6%) Frame = -1 Query: 167 FLQG--RPPDWQDFVGIIVLLIINSTISFIEE 78 F QG +P D+ DF GI+VLL+INSTISFIEE Sbjct: 87 FTQGGSKPADYHDFFGILVLLVINSTISFIEE 118 >ref|XP_004306988.1| PREDICTED: plasma membrane ATPase 1-like [Fragaria vesca subsp. vesca] Length = 966 Score = 67.0 bits (162), Expect(2) = 1e-16 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L+ FGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LESFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 44.7 bits (104), Expect(2) = 1e-16 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 2/32 (6%) Frame = -1 Query: 167 FLQG--RPPDWQDFVGIIVLLIINSTISFIEE 78 F QG + D+ DFVGIIVLLIINSTISFIEE Sbjct: 87 FTQGGKKDADYHDFVGIIVLLIINSTISFIEE 118 >gb|EXB37636.1| Plasma membrane ATPase 1 [Morus notabilis] Length = 996 Score = 65.1 bits (157), Expect(2) = 8e-16 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L +FGYNKLEEK+ESK KFLGFMWNPLSWVME Sbjct: 46 LDMFGYNKLEEKKESKILKFLGFMWNPLSWVME 78 Score = 43.9 bits (102), Expect(2) = 8e-16 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -1 Query: 167 FLQGRPPDWQDFVGIIVLLIINSTISFIEE 78 F+QG D+ DF GI LLIINSTISFIEE Sbjct: 119 FVQGNKVDYPDFAGITALLIINSTISFIEE 148 >ref|XP_002979990.1| hypothetical protein SELMODRAFT_419690 [Selaginella moellendorffii] gi|300152217|gb|EFJ18860.1| hypothetical protein SELMODRAFT_419690 [Selaginella moellendorffii] Length = 1144 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 LKIFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 44 LKIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 76 >ref|XP_002991931.1| hypothetical protein SELMODRAFT_430150 [Selaginella moellendorffii] gi|300140317|gb|EFJ07042.1| hypothetical protein SELMODRAFT_430150 [Selaginella moellendorffii] Length = 875 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 LKIFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 44 LKIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 76 >ref|XP_002517457.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative [Ricinus communis] gi|223543468|gb|EEF44999.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative [Ricinus communis] Length = 762 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEKQESKF KFLGFMWNPLSWVME Sbjct: 46 LTIFGYNKLEEKQESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII+LL INSTISFIEE Sbjct: 92 GKPPDWQDFVGIIILLFINSTISFIEE 118 >ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum] gi|114332|sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton pump 1 gi|170464|gb|AAA34173.1| H+-ATPase [Solanum lycopersicum] gi|228405|prf||1803518A H ATPase Length = 956 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LSIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LLIINSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLIINSTISFIEE 118 >ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis] Length = 954 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LSIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LL+INSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLVINSTISFIEE 118 >ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum] Length = 956 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LSIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LLIINSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLIINSTISFIEE 118 >ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina] gi|557541927|gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina] Length = 954 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LSIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LL+INSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLVINSTISFIEE 118 >gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia] Length = 388 Score = 68.9 bits (167), Expect = 6e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LSIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LLIINSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLIINSTISFIEE 118 >gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis] Length = 950 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LTIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 >ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum] Length = 956 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LAIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LL+INSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLVINSTISFIEE 118 >ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer arietinum] Length = 958 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 48 LTIFGYNKLEEKRESKFLKFLGFMWNPLSWVME 80 >ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X2 [Cicer arietinum] Length = 960 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 48 LTIFGYNKLEEKRESKFLKFLGFMWNPLSWVME 80 >ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X1 [Cicer arietinum] Length = 979 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 48 LTIFGYNKLEEKRESKFLKFLGFMWNPLSWVME 80 >gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia] Length = 956 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LAIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LL+INSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLVINSTISFIEE 118 >ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum] gi|5901757|gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum] gi|9789539|gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum] Length = 956 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LAIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LL+INSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLVINSTISFIEE 118 >ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum] gi|435003|emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum] Length = 956 Score = 68.6 bits (166), Expect = 8e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LAIFGYNKLEEKKESKFLKFLGFMWNPLSWVME 78 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LL+INSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLVINSTISFIEE 118 >sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton pump 3 gi|170295|gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia] Length = 956 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 385 LKIFGYNKLEEKQESKFFKFLGFMWNPLSWVME 287 L IFGYNKLEEK+ESKF KFLGFMWNPLSWVME Sbjct: 46 LSIFGYNKLEEKKESKFSKFLGFMWNPLSWVME 78 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 158 GRPPDWQDFVGIIVLLIINSTISFIEE 78 G+PPDWQDFVGII LLIINSTISFIEE Sbjct: 92 GKPPDWQDFVGIITLLIINSTISFIEE 118