BLASTX nr result
ID: Ephedra27_contig00012595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00012595 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137960.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 70 2e-10 ref|XP_006480598.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 69 5e-10 ref|XP_006428880.1| hypothetical protein CICLE_v10010897mg [Citr... 69 5e-10 ref|XP_006837874.1| hypothetical protein AMTR_s00100p00119160 [A... 68 1e-09 gb|EMJ00872.1| hypothetical protein PRUPE_ppa000080mg [Prunus pe... 68 1e-09 gb|ESW16521.1| hypothetical protein PHAVU_007G163300g [Phaseolus... 68 1e-09 ref|XP_006843232.1| hypothetical protein AMTR_s00080p00063640 [A... 68 1e-09 gb|EPS69274.1| hypothetical protein M569_05489 [Genlisea aurea] 68 1e-09 gb|EOY07743.1| Ubiquitin protein ligase E3a, putative isoform 1 ... 68 1e-09 ref|XP_004497459.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 68 1e-09 ref|XP_004246696.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 68 1e-09 gb|AFW82267.1| hypothetical protein ZEAMMB73_111992 [Zea mays] 68 1e-09 ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 68 1e-09 ref|XP_003541402.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 68 1e-09 ref|XP_003537253.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 68 1e-09 emb|CBI32615.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002441232.1| hypothetical protein SORBIDRAFT_09g022820 [S... 68 1e-09 ref|XP_002525185.1| ubiquitin protein ligase E3a, putative [Rici... 68 1e-09 ref|XP_006361773.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-... 67 2e-09 gb|ESW03701.1| hypothetical protein PHAVU_011G035200g [Phaseolus... 67 2e-09 >ref|XP_004137960.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase UPL4-like [Cucumis sativus] Length = 1508 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KEIM E+LLYAI+EGQGSFHLS Sbjct: 1473 MTCANYLKLPPYSSKEIMKEKLLYAITEGQGSFHLS 1508 >ref|XP_006480598.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Citrus sinensis] gi|568853949|ref|XP_006480599.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Citrus sinensis] Length = 1523 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE+M E+LLYAI+EGQGSFHLS Sbjct: 1488 MTCANYLKLPPYSSKEMMKEKLLYAITEGQGSFHLS 1523 >ref|XP_006428880.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|567872583|ref|XP_006428881.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|557530937|gb|ESR42120.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] gi|557530938|gb|ESR42121.1| hypothetical protein CICLE_v10010897mg [Citrus clementina] Length = 1523 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE+M E+LLYAI+EGQGSFHLS Sbjct: 1488 MTCANYLKLPPYSSKEMMKEKLLYAITEGQGSFHLS 1523 >ref|XP_006837874.1| hypothetical protein AMTR_s00100p00119160 [Amborella trichopoda] gi|548840243|gb|ERN00443.1| hypothetical protein AMTR_s00100p00119160 [Amborella trichopoda] Length = 1871 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS KEIML++LLYA+SEGQGSF LS Sbjct: 1836 MTCANYLKLPPYSTKEIMLKKLLYAVSEGQGSFDLS 1871 >gb|EMJ00872.1| hypothetical protein PRUPE_ppa000080mg [Prunus persica] Length = 1896 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS KE+ML++LLYAISEGQGSF LS Sbjct: 1861 MTCANYLKLPPYSTKEVMLKKLLYAISEGQGSFDLS 1896 >gb|ESW16521.1| hypothetical protein PHAVU_007G163300g [Phaseolus vulgaris] Length = 1548 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1513 MTCANYLKLPPYSSKERMKEKLLYAITEGQGSFHLS 1548 >ref|XP_006843232.1| hypothetical protein AMTR_s00080p00063640 [Amborella trichopoda] gi|548845516|gb|ERN04907.1| hypothetical protein AMTR_s00080p00063640 [Amborella trichopoda] Length = 1661 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+K+ M ERLLYAI+EGQGSFHLS Sbjct: 1626 MTCANYLKLPPYSSKDQMRERLLYAITEGQGSFHLS 1661 >gb|EPS69274.1| hypothetical protein M569_05489 [Genlisea aurea] Length = 1882 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYSNKEIM ++L+YAISEGQGSF LS Sbjct: 1847 MTCANYLKLPPYSNKEIMYKKLVYAISEGQGSFDLS 1882 >gb|EOY07743.1| Ubiquitin protein ligase E3a, putative isoform 1 [Theobroma cacao] gi|508715848|gb|EOY07745.1| Ubiquitin protein ligase E3a, putative isoform 1 [Theobroma cacao] Length = 1571 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1536 MTCANYLKLPPYSSKERMKEKLLYAITEGQGSFHLS 1571 >ref|XP_004497459.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Cicer arietinum] gi|502121839|ref|XP_004497460.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Cicer arietinum] Length = 1556 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1521 MTCANYLKLPPYSSKEKMKEKLLYAITEGQGSFHLS 1556 >ref|XP_004246696.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Solanum lycopersicum] Length = 1553 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1518 MTCANYLKLPPYSSKEKMKEKLLYAITEGQGSFHLS 1553 >gb|AFW82267.1| hypothetical protein ZEAMMB73_111992 [Zea mays] Length = 1210 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1175 MTCANYLKLPPYSSKEKMREKLLYAITEGQGSFHLS 1210 >ref|XP_002273203.2| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Vitis vinifera] Length = 1575 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1540 MTCANYLKLPPYSSKERMKEKLLYAITEGQGSFHLS 1575 >ref|XP_003541402.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Glycine max] gi|571498080|ref|XP_006594113.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Glycine max] gi|571498082|ref|XP_006594114.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X3 [Glycine max] Length = 1558 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1523 MTCANYLKLPPYSSKERMKEKLLYAITEGQGSFHLS 1558 >ref|XP_003537253.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X1 [Glycine max] gi|571481726|ref|XP_006588751.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X2 [Glycine max] gi|571481728|ref|XP_006588752.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X3 [Glycine max] gi|571481730|ref|XP_006588753.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X4 [Glycine max] gi|571481733|ref|XP_006588754.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X5 [Glycine max] gi|571481735|ref|XP_006588755.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like isoform X6 [Glycine max] Length = 1557 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1522 MTCANYLKLPPYSSKERMKEKLLYAITEGQGSFHLS 1557 >emb|CBI32615.3| unnamed protein product [Vitis vinifera] Length = 1487 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1452 MTCANYLKLPPYSSKERMKEKLLYAITEGQGSFHLS 1487 >ref|XP_002441232.1| hypothetical protein SORBIDRAFT_09g022820 [Sorghum bicolor] gi|241946517|gb|EES19662.1| hypothetical protein SORBIDRAFT_09g022820 [Sorghum bicolor] Length = 1514 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1479 MTCANYLKLPPYSSKEKMREKLLYAITEGQGSFHLS 1514 >ref|XP_002525185.1| ubiquitin protein ligase E3a, putative [Ricinus communis] gi|223535482|gb|EEF37151.1| ubiquitin protein ligase E3a, putative [Ricinus communis] Length = 1561 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI+EGQGSFHLS Sbjct: 1526 MTCANYLKLPPYSSKEKMKEKLLYAITEGQGSFHLS 1561 >ref|XP_006361773.1| PREDICTED: E3 ubiquitin-protein ligase UPL4-like [Solanum tuberosum] Length = 1554 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KE M E+LLYAI EGQGSFHLS Sbjct: 1519 MTCANYLKLPPYSSKEKMKEKLLYAIMEGQGSFHLS 1554 >gb|ESW03701.1| hypothetical protein PHAVU_011G035200g [Phaseolus vulgaris] gi|561004708|gb|ESW03702.1| hypothetical protein PHAVU_011G035200g [Phaseolus vulgaris] Length = 1878 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 1 MTCANYLKLPPYSNKEIMLERLLYAISEGQGSFHLS 108 MTCANYLKLPPYS+KEIM ++LLYAISEGQGSF LS Sbjct: 1843 MTCANYLKLPPYSSKEIMYKKLLYAISEGQGSFDLS 1878