BLASTX nr result
ID: Ephedra27_contig00012305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00012305 (713 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002870203.1| hypothetical protein ARALYDRAFT_493298 [Arab... 57 8e-06 >ref|XP_002870203.1| hypothetical protein ARALYDRAFT_493298 [Arabidopsis lyrata subsp. lyrata] gi|297316039|gb|EFH46462.1| hypothetical protein ARALYDRAFT_493298 [Arabidopsis lyrata subsp. lyrata] Length = 499 Score = 56.6 bits (135), Expect = 8e-06 Identities = 25/57 (43%), Positives = 38/57 (66%) Frame = +1 Query: 541 PTPAKAQVVALKDAFVPLKSDEEELISTAFKGQKRKEVLVMHEESNIEISREKLRCL 711 P P + +V ++ F+PL DEE ++ AF G+ R++VL HE SNI+I+ E L+CL Sbjct: 252 PKPVEKRVEVPREPFIPLTEDEEAEVNRAFSGRNRRKVLATHENSNIDITGEVLQCL 308