BLASTX nr result
ID: Ephedra27_contig00011601
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00011601 (398 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medica... 57 3e-06 ref|NP_001275425.1| ADP-ribosylation factor 2-like [Solanum tube... 56 6e-06 ref|XP_003578999.1| PREDICTED: ADP-ribosylation factor 1-like [B... 56 6e-06 dbj|BAK00965.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japonica Group] g... 55 7e-06 ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidopsis thaliana... 55 7e-06 gb|ESW19405.1| hypothetical protein PHAVU_006G122200g [Phaseolus... 55 7e-06 ref|XP_006399980.1| hypothetical protein EUTSA_v10014797mg [Eutr... 55 7e-06 gb|EMT07036.1| ADP-ribosylation factor 1 [Aegilops tauschii] 55 7e-06 gb|EMS48325.1| ADP-ribosylation factor 1 [Triticum urartu] 55 7e-06 ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1-like is... 55 7e-06 gb|AAD17207.1| ADP-ribosylation factor [Glycine max] 55 7e-06 gb|AAO63779.1| ADP-ribosylation factor 1 [Populus tremuloides] 55 7e-06 ref|NP_001274832.1| ADP-ribosylation factor 1-like protein [Sola... 55 7e-06 gb|AFK39359.1| unknown [Medicago truncatula] 55 7e-06 ref|XP_003533111.1| PREDICTED: ADP-ribosylation factor 2-B-like ... 55 7e-06 ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula... 55 7e-06 ref|XP_003618208.1| ADP-ribosylation factor [Medicago truncatula... 55 7e-06 dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Prolifera... 55 7e-06 >ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula] gi|355501024|gb|AES82227.1| ADP-ribosylation factor-like protein [Medicago truncatula] Length = 206 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA*FKEVFS 298 QS CATSGEGLYEGLDWLSNNIASK +++FS Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKVNKEKIFS 188 >ref|NP_001275425.1| ADP-ribosylation factor 2-like [Solanum tuberosum] gi|76160966|gb|ABA40446.1| unknown [Solanum tuberosum] Length = 181 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QSACATSGEGLYEGLDWLSNNIA+KA Sbjct: 156 QSACATSGEGLYEGLDWLSNNIANKA 181 >ref|XP_003578999.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon] Length = 181 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QSACATSGEGLYEGLDWLSNNIASK+ Sbjct: 156 QSACATSGEGLYEGLDWLSNNIASKS 181 >dbj|BAK00965.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 181 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QSACATSGEGLYEGLDWLSNNIASK+ Sbjct: 156 QSACATSGEGLYEGLDWLSNNIASKS 181 >ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japonica Group] gi|110825705|sp|Q06396.3|ARF1_ORYSJ RecName: Full=ADP-ribosylation factor 1; AltName: Full=13 kDa cold-induced protein gi|55297503|dbj|BAD68219.1| ADP-ribosylation factor [Oryza sativa Japonica Group] gi|56785043|dbj|BAD82682.1| ADP-ribosylation factor [Oryza sativa Japonica Group] gi|113534130|dbj|BAF06513.1| Os01g0813400 [Oryza sativa Japonica Group] gi|215692811|dbj|BAG88255.1| unnamed protein product [Oryza sativa Japonica Group] gi|215694498|dbj|BAG89491.1| unnamed protein product [Oryza sativa Japonica Group] gi|218189262|gb|EEC71689.1| hypothetical protein OsI_04181 [Oryza sativa Indica Group] gi|222619437|gb|EEE55569.1| hypothetical protein OsJ_03844 [Oryza sativa Japonica Group] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidopsis thaliana] gi|543841|sp|P36397.2|ARF1_ARATH RecName: Full=ADP-ribosylation factor 1; Short=AtARF1 gi|166586|gb|AAA32729.1| ADP-ribosylation factor [Arabidopsis thaliana] gi|2275195|gb|AAB63817.1| ADP-ribosylation factor 1 [Arabidopsis thaliana] gi|18650622|gb|AAL75910.1| At2g47170/T3D7.2 [Arabidopsis thaliana] gi|20198224|gb|AAM15469.1| ADP-ribosylation factor 1 [Arabidopsis thaliana] gi|21592942|gb|AAM64892.1| ADP-ribosylation factor 1 [Arabidopsis thaliana] gi|22655408|gb|AAM98296.1| At2g47170/T3D7.2 [Arabidopsis thaliana] gi|330255716|gb|AEC10810.1| ADP-ribosylation factor 1 [Arabidopsis thaliana] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >gb|ESW19405.1| hypothetical protein PHAVU_006G122200g [Phaseolus vulgaris] Length = 184 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA*FK 310 QS CATSGEGLYEGLDWLSNNI+SK FK Sbjct: 156 QSTCATSGEGLYEGLDWLSNNISSKTSFK 184 >ref|XP_006399980.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum] gi|567173936|ref|XP_006399981.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum] gi|557101070|gb|ESQ41433.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum] gi|557101071|gb|ESQ41434.1| hypothetical protein EUTSA_v10014797mg [Eutrema salsugineum] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >gb|EMT07036.1| ADP-ribosylation factor 1 [Aegilops tauschii] Length = 518 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASK 322 QSACATSGEGLYEGLDWLSNNIASK Sbjct: 116 QSACATSGEGLYEGLDWLSNNIASK 140 >gb|EMS48325.1| ADP-ribosylation factor 1 [Triticum urartu] Length = 498 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASK 322 QSACATSGEGLYEGLDWLSNNIASK Sbjct: 142 QSACATSGEGLYEGLDWLSNNIASK 166 >ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Fragaria vesca subsp. vesca] Length = 184 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >gb|AAD17207.1| ADP-ribosylation factor [Glycine max] Length = 178 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 153 QSTCATSGEGLYEGLDWLSNNIASKA 178 >gb|AAO63779.1| ADP-ribosylation factor 1 [Populus tremuloides] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >ref|NP_001274832.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum] gi|77999251|gb|ABB16972.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum] gi|77999271|gb|ABB16982.1| ADP-ribosylation factor 1-like protein [Solanum tuberosum] gi|82623415|gb|ABB87122.1| ADP-ribosylation factor 1-like [Solanum tuberosum] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >gb|AFK39359.1| unknown [Medicago truncatula] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >ref|XP_003533111.1| PREDICTED: ADP-ribosylation factor 2-B-like [Glycine max] Length = 184 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA*FK 310 QS CATSGEGLYEGLDWLSNNI+ KA FK Sbjct: 156 QSTCATSGEGLYEGLDWLSNNISGKASFK 184 >ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula] gi|355493222|gb|AES74425.1| ADP-ribosylation factor [Medicago truncatula] Length = 248 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 223 QSTCATSGEGLYEGLDWLSNNIASKA 248 >ref|XP_003618208.1| ADP-ribosylation factor [Medicago truncatula] gi|355493223|gb|AES74426.1| ADP-ribosylation factor [Medicago truncatula] Length = 164 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 139 QSTCATSGEGLYEGLDWLSNNIASKA 164 >dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 181 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 156 QSTCATSGEGLYEGLDWLSNNIASKA 181 >pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b gi|320089751|pdb|3AQ4|B Chain B, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -3 Query: 396 QSACATSGEGLYEGLDWLSNNIASKA 319 QS CATSGEGLYEGLDWLSNNIASKA Sbjct: 159 QSTCATSGEGLYEGLDWLSNNIASKA 184