BLASTX nr result
ID: Ephedra27_contig00011483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00011483 (388 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842487.1| hypothetical protein AMTR_s00077p00085930 [A... 60 4e-07 >ref|XP_006842487.1| hypothetical protein AMTR_s00077p00085930 [Amborella trichopoda] gi|548844573|gb|ERN04162.1| hypothetical protein AMTR_s00077p00085930 [Amborella trichopoda] Length = 407 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -1 Query: 388 YVVKTLDNAESVKLQYRSLEKVGDHHSSNNLSQKAIRSSWL 266 YVVKTLDNAESVKLQYRSL KVG+H S KAI +WL Sbjct: 367 YVVKTLDNAESVKLQYRSLAKVGEHRPPTEKSNKAISPNWL 407