BLASTX nr result
ID: Ephedra27_contig00011458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00011458 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW09141.1| hypothetical protein CL4262Contig1_02, partial [P... 57 2e-06 ref|XP_001764980.1| predicted protein [Physcomitrella patens] gi... 57 3e-06 ref|XP_001757287.1| histone H1 linker [Physcomitrella patens] gi... 57 3e-06 >gb|AEW09141.1| hypothetical protein CL4262Contig1_02, partial [Pinus radiata] gi|383162902|gb|AFG64152.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162904|gb|AFG64153.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162906|gb|AFG64154.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162908|gb|AFG64155.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162910|gb|AFG64156.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162912|gb|AFG64157.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162914|gb|AFG64158.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162916|gb|AFG64159.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162918|gb|AFG64160.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162920|gb|AFG64161.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162922|gb|AFG64162.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162924|gb|AFG64163.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162926|gb|AFG64164.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162928|gb|AFG64165.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162930|gb|AFG64166.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] gi|383162932|gb|AFG64167.1| hypothetical protein CL4262Contig1_02, partial [Pinus taeda] Length = 82 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +2 Query: 2 IEKAVGEKYKTHLPSNFGKRILFFLRKYTKEGKLVKVKGSFKLSDEL 142 I K +G KYK LP N+ K +L LR+ +K GKL KVKGS+KLSDEL Sbjct: 11 IAKFIGAKYKAVLPGNYEKLLLVQLRRLSKSGKLTKVKGSYKLSDEL 57 >ref|XP_001764980.1| predicted protein [Physcomitrella patens] gi|162683789|gb|EDQ70196.1| predicted protein [Physcomitrella patens] Length = 292 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +2 Query: 2 IEKAVGEKYKTHLPSNFGKRILFFLRKYTKEGKLVKVKGSFKLSDEL 142 I K + +KYKT LP NF K + LR TK GKLVKVK SFKLSDE+ Sbjct: 85 IAKYLEDKYKTGLPPNFKKTLTIQLRNLTKSGKLVKVKNSFKLSDEI 131 >ref|XP_001757287.1| histone H1 linker [Physcomitrella patens] gi|162691410|gb|EDQ77772.1| histone H1 linker [Physcomitrella patens] Length = 285 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = +2 Query: 2 IEKAVGEKYKTHLPSNFGKRILFFLRKYTKEGKLVKVKGSFKLSDEL 142 I K + +KYKT LP NF K + LR TK GKLVKVK SFKLSDEL Sbjct: 100 IAKYLEDKYKTGLPPNFKKMLTTQLRNLTKAGKLVKVKNSFKLSDEL 146