BLASTX nr result
ID: Ephedra27_contig00011294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00011294 (684 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF14740.1| cytochrome oxidase subunit I [Plumbago sp. CLP-2006] 69 1e-09 gb|AAD01658.1| cytochrome c oxidase [Ephedra viridis] 68 3e-09 gb|AAD01667.1| cytochrome c oxidase [Phyllocladus trichomanoides] 68 3e-09 gb|AAD01679.1| cytochrome c oxidase [Ephedra distachya] 68 3e-09 gb|AAD01659.1| cytochrome c oxidase [Ginkgo biloba] 68 3e-09 gb|AAD01670.1| cytochrome c oxidase [Sciadopitys verticillata] 68 3e-09 gb|AAD01651.1| cytochrome c oxidase [Agathis australis] 68 3e-09 gb|AAD01669.1| cytochrome c oxidase [Podocarpus macrophyllus] 68 3e-09 gb|ACB15029.1| cytochrome c oxidase [Saxegothaea conspicua] 68 3e-09 gb|ACB15027.1| cytochrome c oxidase [Prumnopitys ladei] 68 3e-09 gb|ACB15017.1| cytochrome c oxidase [Lagarostrobos franklinii] 68 3e-09 gb|ACB15006.1| cytochrome c oxidase [Afrocarpus falcatus] 68 3e-09 gb|ACB15004.1| cytochrome c oxidase [Acmopyle pancheri] 68 3e-09 gb|ABX89570.1| cytochrome oxidase subunit 1 [Wollemia nobilis] 68 3e-09 gb|ABX89564.1| cytochrome oxidase subunit 1 [Agathis alba] gi|16... 68 3e-09 gb|ABN50286.1| cytochrome oxidase subunit I [Ephedra major] 68 3e-09 gb|ABN50278.1| cytochrome oxidase subunit I [Ephedra intermedia] 68 3e-09 gb|ABN50276.1| cytochrome oxidase subunit I [Ephedra intermedia] 68 3e-09 gb|ABN50279.1| cytochrome oxidase subunit I [Ephedra przewalskii] 68 3e-09 gb|ABN50280.1| cytochrome oxidase subunit I [Ephedra sp. Tibet-7] 68 3e-09 >gb|ABF14740.1| cytochrome oxidase subunit I [Plumbago sp. CLP-2006] Length = 471 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +3 Query: 276 HHQIF*YDLIVILLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +HQ++ I+LITAHAFLMIFFMVMPA+IGGFGNWFVPILI Sbjct: 18 NHQLY------IVLITAHAFLMIFFMVMPAMIGGFGNWFVPILI 55 >gb|AAD01658.1| cytochrome c oxidase [Ephedra viridis] Length = 470 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|AAD01667.1| cytochrome c oxidase [Phyllocladus trichomanoides] Length = 471 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|AAD01679.1| cytochrome c oxidase [Ephedra distachya] Length = 471 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|AAD01659.1| cytochrome c oxidase [Ginkgo biloba] Length = 468 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|AAD01670.1| cytochrome c oxidase [Sciadopitys verticillata] Length = 469 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|AAD01651.1| cytochrome c oxidase [Agathis australis] Length = 471 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|AAD01669.1| cytochrome c oxidase [Podocarpus macrophyllus] Length = 471 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|ACB15029.1| cytochrome c oxidase [Saxegothaea conspicua] Length = 472 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 25 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 56 >gb|ACB15027.1| cytochrome c oxidase [Prumnopitys ladei] Length = 472 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 25 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 56 >gb|ACB15017.1| cytochrome c oxidase [Lagarostrobos franklinii] Length = 472 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 25 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 56 >gb|ACB15006.1| cytochrome c oxidase [Afrocarpus falcatus] Length = 472 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 25 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 56 >gb|ACB15004.1| cytochrome c oxidase [Acmopyle pancheri] Length = 472 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 25 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 56 >gb|ABX89570.1| cytochrome oxidase subunit 1 [Wollemia nobilis] Length = 469 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|ABX89564.1| cytochrome oxidase subunit 1 [Agathis alba] gi|162423586|gb|ABX89565.1| cytochrome oxidase subunit 1 [Agathis dammara] Length = 469 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 24 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 55 >gb|ABN50286.1| cytochrome oxidase subunit I [Ephedra major] Length = 452 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 11 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 42 >gb|ABN50278.1| cytochrome oxidase subunit I [Ephedra intermedia] Length = 462 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 19 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 50 >gb|ABN50276.1| cytochrome oxidase subunit I [Ephedra intermedia] Length = 461 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 19 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 50 >gb|ABN50279.1| cytochrome oxidase subunit I [Ephedra przewalskii] Length = 456 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 19 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 50 >gb|ABN50280.1| cytochrome oxidase subunit I [Ephedra sp. Tibet-7] Length = 470 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 312 LLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 407 +LITAHAFLMIFFMVMPAVIGGFGNWFVPILI Sbjct: 20 VLITAHAFLMIFFMVMPAVIGGFGNWFVPILI 51