BLASTX nr result
ID: Ephedra27_contig00011107
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00011107 (599 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22463.1| unknown [Picea sitchensis] gi|116793226|gb|ABK266... 61 3e-07 gb|ABK21222.1| unknown [Picea sitchensis] gi|116790907|gb|ABK257... 60 6e-07 ref|XP_002987765.1| rab family GTPase [Selaginella moellendorffi... 57 3e-06 >gb|ABK22463.1| unknown [Picea sitchensis] gi|116793226|gb|ABK26663.1| unknown [Picea sitchensis] gi|224284237|gb|ACN39854.1| unknown [Picea sitchensis] Length = 200 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = +1 Query: 1 LFYEIARKLPKAKPAQQPAGMVLADRAAERPK-SNCCS 111 LFYEIAR+LPKA+P Q PAGMVLADR+AER + S+CCS Sbjct: 163 LFYEIARRLPKAEPVQHPAGMVLADRSAERARSSSCCS 200 >gb|ABK21222.1| unknown [Picea sitchensis] gi|116790907|gb|ABK25786.1| unknown [Picea sitchensis] Length = 200 Score = 59.7 bits (143), Expect = 6e-07 Identities = 28/38 (73%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +1 Query: 1 LFYEIARKLPKAKPAQQPAGMVLADRAAERPKS-NCCS 111 LFYEIAR+LPKA+P QQPAGMVL DR AER ++ +CCS Sbjct: 163 LFYEIARRLPKARPVQQPAGMVLTDRPAERARTYSCCS 200 >ref|XP_002987765.1| rab family GTPase [Selaginella moellendorffii] gi|302821214|ref|XP_002992271.1| rab family GTPase [Selaginella moellendorffii] gi|300139921|gb|EFJ06652.1| rab family GTPase [Selaginella moellendorffii] gi|300144384|gb|EFJ11068.1| rab family GTPase [Selaginella moellendorffii] Length = 199 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 1 LFYEIARKLPKAKPAQQPAGMVLADRAAERPKSNCCS 111 LFYEIARKLPKA+PAQQ GMVL DR E KS CC+ Sbjct: 163 LFYEIARKLPKAQPAQQNTGMVLTDRPIETKKSACCN 199