BLASTX nr result
ID: Ephedra27_contig00011017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00011017 (642 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004304399.1| PREDICTED: interactor of constitutive active... 56 8e-06 >ref|XP_004304399.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 615 Score = 56.2 bits (134), Expect = 8e-06 Identities = 40/79 (50%), Positives = 47/79 (59%) Frame = +3 Query: 3 KAADAAATILSAHNGDLNGKLVERTASLDKHILQDSDVYNHRLSSPAMSDDLQHLDHSPT 182 KAA+AAA ILS N NGK VERT SLD H YN LSSP S+DL D SP Sbjct: 550 KAAEAAAAILSTGN---NGKFVERTGSLDSH-------YN-PLSSP-YSEDLD--DDSPK 595 Query: 183 RKKNVMMRKFSNIWKKKEQ 239 +K M++K +WKK+ Q Sbjct: 596 KKNVTMLKKIGVLWKKQGQ 614