BLASTX nr result
ID: Ephedra27_contig00010694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00010694 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446616.1| hypothetical protein SORBIDRAFT_06g018970 [S... 57 3e-06 ref|XP_004141446.1| PREDICTED: casparian strip membrane protein ... 55 1e-05 >ref|XP_002446616.1| hypothetical protein SORBIDRAFT_06g018970 [Sorghum bicolor] gi|288558961|sp|C5Y9U6.1|CASP1_SORBI RecName: Full=Casparian strip membrane protein Sb06g018970 gi|241937799|gb|EES10944.1| hypothetical protein SORBIDRAFT_06g018970 [Sorghum bicolor] Length = 192 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = +3 Query: 159 MPLSVFHIIRPHMLVTRALVLLPLDCVVLAVLTSGASAAASMHYLANKGNSHAS 320 +PLS+ HIIRP +R L+L+ D V+LA+LT+GASAAA++ YLA+KGN A+ Sbjct: 96 IPLSIVHIIRPRARYSR-LILVFFDAVMLALLTAGASAAAAIVYLAHKGNVRAN 148 >ref|XP_004141446.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus] gi|449527611|ref|XP_004170803.1| PREDICTED: casparian strip membrane protein 1-like [Cucumis sativus] Length = 186 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +3 Query: 159 MPLSVFHIIRPHMLVTRALVLLPLDCVVLAVLTSGASAAASMHYLANKGN 308 +PLS+FHI+R TR +VL+ LD ++A+LTSGASAAA++ YLA+KGN Sbjct: 90 LPLSIFHILRSRARATR-VVLVFLDAGMMALLTSGASAAAAIVYLAHKGN 138