BLASTX nr result
ID: Ephedra27_contig00010380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00010380 (439 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852753.1| hypothetical protein AMTR_s00033p00119910 [A... 63 4e-08 gb|ABK26315.1| unknown [Picea sitchensis] 56 4e-06 >ref|XP_006852753.1| hypothetical protein AMTR_s00033p00119910 [Amborella trichopoda] gi|548856367|gb|ERN14220.1| hypothetical protein AMTR_s00033p00119910 [Amborella trichopoda] Length = 212 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +1 Query: 256 LHRRLHHSLT-RARAVGEKGDSSGEESPESLFRKELKRRGLSPTSLLEDDDRKSY 417 LH R SLT R + + DS+GEE PESLF KEL++RGL+PTSLLED + SY Sbjct: 38 LHARFRGSLTVRCKLSEDNSDSNGEEPPESLFMKELRKRGLTPTSLLEDSENSSY 92 >gb|ABK26315.1| unknown [Picea sitchensis] Length = 248 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +1 Query: 310 GDSSGEESPESLFRKELKRRGLSPTSLLEDDDRKSYSSSTTGT 438 GD SGEE PE+LF KELKRRG++P SL E++D+ Y +T T Sbjct: 82 GDPSGEEPPETLFMKELKRRGMTPASLFEENDKSPYGLGSTET 124