BLASTX nr result
ID: Ephedra27_contig00010257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00010257 (650 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ18279.1| hypothetical protein PRUPE_ppa000693mg [Prunus pe... 59 9e-07 ref|XP_004161424.1| PREDICTED: putative SWI/SNF-related matrix-a... 56 8e-06 ref|XP_004139464.1| PREDICTED: putative SWI/SNF-related matrix-a... 56 8e-06 >gb|EMJ18279.1| hypothetical protein PRUPE_ppa000693mg [Prunus persica] Length = 1033 Score = 59.3 bits (142), Expect = 9e-07 Identities = 31/65 (47%), Positives = 40/65 (61%) Frame = -1 Query: 560 MGSLHNREKIKEMRCILGSDVADSDIIRALFMAKDDVVRAINIFFDTPSFHRKDRKSAGS 381 MG+ E + +R I+GS +D DIIRAL MA +DV AINI FDTPSF K+R Sbjct: 1 MGNKVTEELLSTVRTIVGSAYSDMDIIRALHMANNDVTAAINIIFDTPSFKSKERSGFPK 60 Query: 380 GSRLM 366 +L+ Sbjct: 61 KPKLL 65 >ref|XP_004161424.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Cucumis sativus] Length = 1040 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = -1 Query: 560 MGSLHNREKIKEMRCILGSDVADSDIIRALFMAKDDVVRAINIFFDTPSFHRKDR 396 MGS N E + +R I+G D + D+IRAL +AK+D AINI +DTPSF +D+ Sbjct: 1 MGSKINDELVSTVRSIVGPDFSYMDVIRALHLAKNDATAAINIIYDTPSFGTRDK 55 >ref|XP_004139464.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Cucumis sativus] Length = 1040 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/55 (49%), Positives = 37/55 (67%) Frame = -1 Query: 560 MGSLHNREKIKEMRCILGSDVADSDIIRALFMAKDDVVRAINIFFDTPSFHRKDR 396 MGS N E + +R I+G D + D+IRAL +AK+D AINI +DTPSF +D+ Sbjct: 1 MGSKINDELVSTVRSIVGPDFSYMDVIRALHLAKNDATAAINIIYDTPSFGTRDK 55