BLASTX nr result
ID: Ephedra27_contig00009655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00009655 (1145 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173099.1| PREDICTED: uncharacterized protein LOC101231... 67 1e-08 ref|XP_004150997.1| PREDICTED: uncharacterized protein LOC101210... 67 1e-08 >ref|XP_004173099.1| PREDICTED: uncharacterized protein LOC101231508, partial [Cucumis sativus] Length = 643 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 1/76 (1%) Frame = -2 Query: 829 DPEKNKVSNFYE-DEAWYVLTILARLGSPSSPQEIVSRCRLVSLTEAQVKALCVLPGSPI 653 DP + + E +AWY+ TIL +G P+S +E+ +RC L S T V+ LC +P SPI Sbjct: 8 DPSEYSLHTTVELQKAWYLFTILLDIGRPASLEELAARCELFSATACMVRYLCEIPDSPI 67 Query: 652 SLSDDGLVFLSKEAVS 605 L DD LV++S A+S Sbjct: 68 CLGDDALVYISIVAIS 83 >ref|XP_004150997.1| PREDICTED: uncharacterized protein LOC101210717 [Cucumis sativus] Length = 982 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 1/76 (1%) Frame = -2 Query: 829 DPEKNKVSNFYE-DEAWYVLTILARLGSPSSPQEIVSRCRLVSLTEAQVKALCVLPGSPI 653 DP + + E +AWY+ TIL +G P+S +E+ +RC L S T V+ LC +P SPI Sbjct: 8 DPSEYSLHTTVELQKAWYLFTILLDIGRPASLEELAARCELFSATACMVRYLCEIPDSPI 67 Query: 652 SLSDDGLVFLSKEAVS 605 L DD LV++S A+S Sbjct: 68 CLGDDALVYISIVAIS 83