BLASTX nr result
ID: Ephedra27_contig00009608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00009608 (423 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003620250.1| Chitinase [Medicago truncatula] gi|355495265... 59 7e-07 ref|XP_002321722.2| hypothetical protein POPTR_0015s11260g, part... 59 9e-07 ref|XP_002281665.1| PREDICTED: chitinase 2-like [Vitis vinifera] 58 1e-06 emb|CAN76732.1| hypothetical protein VITISV_042829 [Vitis vinifera] 58 1e-06 ref|XP_006828243.1| hypothetical protein AMTR_s00023p00192080 [A... 58 1e-06 ref|XP_004294633.1| PREDICTED: chitinase 2-like isoform 2 [Fraga... 57 2e-06 ref|XP_004294632.1| PREDICTED: chitinase 2-like isoform 1 [Fraga... 57 2e-06 ref|XP_002321723.2| hypothetical protein POPTR_0015s11270g [Popu... 57 3e-06 ref|XP_004305003.1| PREDICTED: chitinase 2-like [Fragaria vesca ... 57 3e-06 ref|XP_003533116.1| PREDICTED: chitinase 1-like [Glycine max] 57 3e-06 ref|XP_002318148.1| hypothetical protein POPTR_0012s10410g [Popu... 57 3e-06 sp|Q9SLP4.1|CHIT1_TULBA RecName: Full=Chitinase 1; AltName: Full... 56 4e-06 ref|XP_006828242.1| hypothetical protein AMTR_s00023p00191860 [A... 56 4e-06 ref|XP_002532811.1| Chitinase 1 precursor, putative [Ricinus com... 56 4e-06 sp|Q7M443.1|CHIT2_TULBA RecName: Full=Chitinase 2; AltName: Full... 56 6e-06 gb|EMJ06812.1| hypothetical protein PRUPE_ppa009096mg [Prunus pe... 56 6e-06 tpg|DAA55071.1| TPA: hypothetical protein ZEAMMB73_243866 [Zea m... 55 1e-05 >ref|XP_003620250.1| Chitinase [Medicago truncatula] gi|355495265|gb|AES76468.1| Chitinase [Medicago truncatula] Length = 306 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 37/51 (72%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL PS GFF ACQ+LK +Q L GI ++SAD + G GF+ E Q+QALLA Sbjct: 256 GGLSPSDGFFKACQRLKSQQKLHGIFVWSADD--SMGNGFRFEKQSQALLA 304 >ref|XP_002321722.2| hypothetical protein POPTR_0015s11260g, partial [Populus trichocarpa] gi|550322478|gb|EEF05849.2| hypothetical protein POPTR_0015s11260g, partial [Populus trichocarpa] Length = 279 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL PS GFF AC +LK ++ L+GI ++SAD +KA GF+ E Q+QALLA Sbjct: 228 GGLSPSDGFFTACSKLKSQKQLQGIFVWSADDSKAE--GFRYEKQSQALLA 276 >ref|XP_002281665.1| PREDICTED: chitinase 2-like [Vitis vinifera] Length = 304 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFF AC +LK +Q L GI I+SAD +KA GF+ E Q+QALLA Sbjct: 253 GGLSPDDGFFTACNRLKSQQQLHGIFIWSADDSKAK--GFRYEKQSQALLA 301 >emb|CAN76732.1| hypothetical protein VITISV_042829 [Vitis vinifera] Length = 588 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFF AC +LK +Q L GI I+SAD +KA GF+ E Q+QALLA Sbjct: 537 GGLSPDDGFFTACNRLKSQQQLHGIFIWSADDSKAK--GFRYEKQSQALLA 585 >ref|XP_006828243.1| hypothetical protein AMTR_s00023p00192080 [Amborella trichopoda] gi|548832890|gb|ERM95659.1| hypothetical protein AMTR_s00023p00192080 [Amborella trichopoda] Length = 296 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/51 (54%), Positives = 39/51 (76%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GGFF ACQ+LK++ L GI ++SAD +K++ GF+ E Q+QA+LA Sbjct: 247 GGLAPGGGFFEACQRLKNEGKLHGIFVWSADDSKSN--GFRYETQSQAVLA 295 >ref|XP_004294633.1| PREDICTED: chitinase 2-like isoform 2 [Fragaria vesca subsp. vesca] Length = 289 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFF AC +LK +Q+L GI ++SAD +K + GF+ E Q+QALLA Sbjct: 238 GGLSPENGFFTACNRLKSEQNLNGIFVWSADDSKKN--GFRYEKQSQALLA 286 >ref|XP_004294632.1| PREDICTED: chitinase 2-like isoform 1 [Fragaria vesca subsp. vesca] Length = 307 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFF AC +LK +Q+L GI ++SAD +K + GF+ E Q+QALLA Sbjct: 256 GGLSPENGFFTACNRLKSEQNLNGIFVWSADDSKKN--GFRYEKQSQALLA 304 >ref|XP_002321723.2| hypothetical protein POPTR_0015s11270g [Populus trichocarpa] gi|550322479|gb|EEF05850.2| hypothetical protein POPTR_0015s11270g [Populus trichocarpa] Length = 351 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = +1 Query: 1 DPSGGGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 D S GGL P GGFF AC++L+ K+ L GI I+SAD++K GF+ E +Q LLA Sbjct: 298 DESEGGLDPDGGFFEACKELQGKEKLGGIFIWSADNSKKH--GFEGEKNSQHLLA 350 >ref|XP_004305003.1| PREDICTED: chitinase 2-like [Fragaria vesca subsp. vesca] Length = 303 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFF AC +LK +Q+L GI ++SAD +K + GF+ E Q+QALLA Sbjct: 252 GGLSPENGFFTACHRLKSEQNLHGIFVWSADDSKKN--GFRYEKQSQALLA 300 >ref|XP_003533116.1| PREDICTED: chitinase 1-like [Glycine max] Length = 311 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GGFF AC LK +Q L GI ++SAD + ++ GF+ E Q+QALLA Sbjct: 261 GGLSPDGGFFTACHTLKSQQKLHGIFVWSADDSMSN--GFRYEKQSQALLA 309 >ref|XP_002318148.1| hypothetical protein POPTR_0012s10410g [Populus trichocarpa] gi|222858821|gb|EEE96368.1| hypothetical protein POPTR_0012s10410g [Populus trichocarpa] Length = 301 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/51 (54%), Positives = 36/51 (70%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P+ GFF AC +LK + L GI ++SAD +KA GF+ E Q+QALLA Sbjct: 250 GGLSPANGFFTACSKLKSQNQLHGIFVWSADDSKA--GGFRYEKQSQALLA 298 >sp|Q9SLP4.1|CHIT1_TULBA RecName: Full=Chitinase 1; AltName: Full=Tulip bulb chitinase-1; Short=TBC-1; Flags: Precursor gi|6594311|dbj|BAA88408.1| bulb chitinase-1 [Tulipa bakeri] Length = 314 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/53 (52%), Positives = 35/53 (66%) Frame = +1 Query: 7 SGGGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 S GGLKP GFF AC LK + L GI ++SAD + S F+ EMQAQ++LA Sbjct: 248 SSGGLKPDNGFFRACSILKKQGKLHGIFVWSADDSLMSNNVFRYEMQAQSMLA 300 >ref|XP_006828242.1| hypothetical protein AMTR_s00023p00191860 [Amborella trichopoda] gi|548832889|gb|ERM95658.1| hypothetical protein AMTR_s00023p00191860 [Amborella trichopoda] Length = 320 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFFNAC++LK L GI ++ AD +K G GFQ E +AQALLA Sbjct: 271 GGLAPGNGFFNACKELKSNGKLFGIFVWCADISK--GNGFQYEQEAQALLA 319 >ref|XP_002532811.1| Chitinase 1 precursor, putative [Ricinus communis] gi|223527431|gb|EEF29568.1| Chitinase 1 precursor, putative [Ricinus communis] Length = 305 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P+ GFF AC +LK + L GI ++SAD +KA+ GF+ E Q+QALLA Sbjct: 254 GGLAPNDGFFTACNRLKSQNQLHGIFVWSADDSKAN--GFRYEKQSQALLA 302 >sp|Q7M443.1|CHIT2_TULBA RecName: Full=Chitinase 2; AltName: Full=Tulip bulb chitinase-2; Short=TBC-2 Length = 275 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/53 (52%), Positives = 36/53 (67%) Frame = +1 Query: 7 SGGGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 + GGLKP GFF+AC LK + L GI ++SAD + S F+ EMQAQ+LLA Sbjct: 222 NSGGLKPRNGFFDACSILKKQGKLHGIFVWSADDSLMSNDVFKYEMQAQSLLA 274 >gb|EMJ06812.1| hypothetical protein PRUPE_ppa009096mg [Prunus persica] Length = 306 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = +1 Query: 13 GGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 GGL P GFF AC +LK +Q L GI ++SAD +K GF+ E Q+QALLA Sbjct: 255 GGLSPENGFFTACHRLKSEQQLHGIFVWSADDSKK--IGFRYEKQSQALLA 303 >tpg|DAA55071.1| TPA: hypothetical protein ZEAMMB73_243866 [Zea mays] Length = 325 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = +1 Query: 1 DPSGGGLKPSGGFFNACQQLKDKQSLKGIVIYSADSTKASGAGFQDEMQAQALLA 165 DP+ GGL+P GFF AC++L+ + L GI +++AD++ A GF+DE AQ LA Sbjct: 266 DPASGGLRPGKGFFRACRELRRQGRLHGIFVWAADNSAAD--GFRDERLAQTFLA 318