BLASTX nr result
ID: Ephedra27_contig00009365
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00009365 (657 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37077.1| unknown [Medicago truncatula] 64 5e-08 ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula... 64 5e-08 ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-li... 63 7e-08 ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-li... 62 2e-07 ref|XP_006601449.1| PREDICTED: methylsterol monooxygenase 1-1-li... 59 1e-06 ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-li... 59 1e-06 ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citr... 59 1e-06 ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-li... 58 2e-06 gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus... 58 2e-06 ref|XP_006851841.1| hypothetical protein AMTR_s00041p00076350 [A... 57 4e-06 gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theob... 57 4e-06 ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family prot... 57 5e-06 ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus... 57 5e-06 gb|ESW06842.1| hypothetical protein PHAVU_010G081300g [Phaseolus... 56 8e-06 ref|XP_004231163.1| PREDICTED: uncharacterized protein LOC101255... 56 8e-06 ref|XP_001765160.1| predicted protein [Physcomitrella patens] gi... 56 8e-06 >gb|AFK37077.1| unknown [Medicago truncatula] Length = 303 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYEKSN 517 SVFTYCDYIYGTDKG+RYQK+ L K ++ + NGA QNG E+ N Sbjct: 254 SVFTYCDYIYGTDKGFRYQKKILQKLKEDSTNGAA-QNGRSYSEQEN 299 >ref|XP_003608797.1| Sterol-4-methyl-oxidase [Medicago truncatula] gi|355509852|gb|AES90994.1| Sterol-4-methyl-oxidase [Medicago truncatula] Length = 303 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYEKSN 517 SVFTYCDYIYGTDKG+RYQK+ L K ++ + NGA QNG E+ N Sbjct: 254 SVFTYCDYIYGTDKGFRYQKKILQKLKEDSTNGAA-QNGRSYSEQEN 299 >ref|XP_003525772.2| PREDICTED: methylsterol monooxygenase 1-1-like isoform X1 [Glycine max] Length = 359 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYE 526 SVFTYCDYIYGTDKGYRYQK+ L K ++ NG VEQNG G Y+ Sbjct: 316 SVFTYCDYIYGTDKGYRYQKKILQKLKEELANG-VEQNG-GSYK 357 >ref|XP_004515763.1| PREDICTED: methylsterol monooxygenase 1-1-like [Cicer arietinum] Length = 303 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGN 538 SVFTYCDYIYGTDKGYRYQK+ L K ++ NGA + G+ Sbjct: 254 SVFTYCDYIYGTDKGYRYQKKILRKLKEELTNGAAQNGGS 293 >ref|XP_006601449.1| PREDICTED: methylsterol monooxygenase 1-1-like [Glycine max] Length = 272 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 651 FTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNG 541 FTYCDYIYGTDKGYRYQK+ L K ++ NG VEQNG Sbjct: 231 FTYCDYIYGTDKGYRYQKKILQKLKEELANG-VEQNG 266 >ref|XP_006477294.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X1 [Citrus sinensis] gi|568846931|ref|XP_006477295.1| PREDICTED: methylsterol monooxygenase 1-2-like isoform X2 [Citrus sinensis] gi|568846933|ref|XP_006477296.1| PREDICTED: methylsterol monooxygenase 1-2-like [Citrus sinensis] Length = 300 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYE 526 SVFTYCD++YGTDKGYRYQK+ L K ++ L G+ EQNG G Y+ Sbjct: 254 SVFTYCDFLYGTDKGYRYQKKLLRKMQE-ELRGSGEQNG-GSYQ 295 >ref|XP_006440422.1| hypothetical protein CICLE_v10021364mg [Citrus clementina] gi|557542684|gb|ESR53662.1| hypothetical protein CICLE_v10021364mg [Citrus clementina] Length = 300 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYE 526 SVFTYCD++YGTDKGYRYQK+ L K ++ L G+ EQNG G Y+ Sbjct: 254 SVFTYCDFLYGTDKGYRYQKKLLRKMQE-ELRGSGEQNG-GSYQ 295 >ref|XP_006363724.1| PREDICTED: methylsterol monooxygenase 1-1-like [Solanum tuberosum] Length = 303 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKAR-KSNLNGAVEQNG 541 SVFTYCDYIYGTDKGYRYQK+ L + + SN NG EQNG Sbjct: 254 SVFTYCDYIYGTDKGYRYQKKVLQQLKGASNANG--EQNG 291 >gb|ESW06841.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris] Length = 302 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYE 526 SVFTYCDYIYGTDKGYRYQK+ L K ++ G EQ G Y+ Sbjct: 254 SVFTYCDYIYGTDKGYRYQKKILQKLKEDLTYG--EQQNGGSYK 295 >ref|XP_006851841.1| hypothetical protein AMTR_s00041p00076350 [Amborella trichopoda] gi|548855424|gb|ERN13308.1| hypothetical protein AMTR_s00041p00076350 [Amborella trichopoda] Length = 291 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 3/40 (7%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARK---SNLNGAVEQ 547 SVFTYCDYIYGTDKGYR+QKE LSK R+ + NG V Q Sbjct: 243 SVFTYCDYIYGTDKGYRFQKEHLSKMRRRWIAEGNGEVPQ 282 >gb|EOY24496.1| Sterol-4alpha-methyl oxidase 1-1 isoform 1 [Theobroma cacao] Length = 304 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/44 (65%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKAR-KSNLNGAVEQNGNGKY 529 SVFTYCDYIYGTDKGYRY K+ L K + +S NGA QNG Y Sbjct: 254 SVFTYCDYIYGTDKGYRYHKKVLRKLKEESRTNGA--QNGGSYY 295 >ref|XP_006368716.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa] gi|550346803|gb|ERP65285.1| STEROL-4ALPHA-METHYL OXIDASE 1-1 family protein [Populus trichocarpa] Length = 304 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKY 529 SVFTYCD+IYGTDKGYR+QK+ L K ++ NG EQNG G Y Sbjct: 254 SVFTYCDFIYGTDKGYRFQKKLLRKLKEGVENGG-EQNG-GSY 294 >ref|XP_002509623.1| C-4 methyl sterol oxidase, putative [Ricinus communis] gi|223549522|gb|EEF51010.1| C-4 methyl sterol oxidase, putative [Ricinus communis] Length = 243 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYEKS 520 SVFTYCD+IYGTDKGYR+QK+ + K ++ NG QNG Y+ + Sbjct: 193 SVFTYCDFIYGTDKGYRFQKKVIKKLKEGLENGG-NQNGGSYYDST 237 >gb|ESW06842.1| hypothetical protein PHAVU_010G081300g [Phaseolus vulgaris] Length = 300 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYE 526 SVFTYCDYIYGTDKGYRYQK+ L +K +L +QNG G Y+ Sbjct: 254 SVFTYCDYIYGTDKGYRYQKKIL---QKEDLTYGEQQNG-GSYK 293 >ref|XP_004231163.1| PREDICTED: uncharacterized protein LOC101255250 [Solanum lycopersicum] Length = 677 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYEKS 520 SVFTYCDYIYGTDKGYRYQKE K R+ L + NG+ KS Sbjct: 255 SVFTYCDYIYGTDKGYRYQKEVFEK-RREKLKMEEKVNGSAPVFKS 299 >ref|XP_001765160.1| predicted protein [Physcomitrella patens] gi|162683479|gb|EDQ69888.1| predicted protein [Physcomitrella patens] Length = 314 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = -1 Query: 657 SVFTYCDYIYGTDKGYRYQKEFLSKARKSNLNGAVEQNGNGKYEKSN 517 SVFTYCD+IYGTDKGYRY KE + + A EQNGNG +K++ Sbjct: 254 SVFTYCDWIYGTDKGYRYMKEMHKRGLVAK-GQAQEQNGNGWLQKND 299