BLASTX nr result
ID: Ephedra27_contig00007405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00007405 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutr... 85 9e-15 ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, part... 85 9e-15 gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa] 85 1e-14 ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana... 84 2e-14 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus... 84 2e-14 ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp.... 84 2e-14 dbj|BAH20390.1| AT1G47128 [Arabidopsis thaliana] 84 2e-14 dbj|BAE98640.1| cysteine proteinase RD21A [Arabidopsis thaliana] 84 2e-14 emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris] 84 2e-14 gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana] gi|19548... 84 2e-14 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis] 83 3e-14 ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula] gi... 83 3e-14 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis] 82 6e-14 ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Popu... 82 7e-14 ref|XP_006855225.1| hypothetical protein AMTR_s00051p00208220 [A... 82 7e-14 gb|AEQ61829.1| cysteine protease [Dimocarpus longan] 82 7e-14 gb|AED99251.1| cysteine protease [Dimocarpus longan] 82 7e-14 ref|NP_568620.1| Granulin repeat cysteine protease family protei... 81 1e-13 gb|AAC49455.1| Pseudotzain [Pseudotsuga menziesii] 81 1e-13 dbj|BAF01762.1| cysteine protease component of protease-inhibito... 81 1e-13 >ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum] gi|557090198|gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum] Length = 459 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/59 (61%), Positives = 43/59 (72%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + S+SR Sbjct: 397 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLMSKNSPFSVKALKRKPATPFWSKSR 455 >ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella] gi|482575989|gb|EOA40176.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella] Length = 509 Score = 85.1 bits (209), Expect = 9e-15 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + SQ R Sbjct: 447 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLMSKNSPFSVKALKRKPATPFWSQGR 505 >gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa] Length = 463 Score = 84.7 bits (208), Expect = 1e-14 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQ-GDCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKR 106 WGCCP ESA CC+ CCPH++P+CD D GTCL SK+NP GVK LKR A+R Sbjct: 397 WGCCPLESATCCDDHSSCCPHEYPICDLDGGTCLMSKDNPLGVKALKRGPARR 449 >ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana] gi|1172873|sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor gi|12321010|gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana] gi|435619|dbj|BAA02374.1| thiol protease [Arabidopsis thaliana] gi|18175926|gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana] gi|22136972|gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana] gi|332194014|gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana] Length = 462 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + SQ R Sbjct: 400 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGR 458 >gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris] Length = 466 Score = 84.3 bits (207), Expect = 2e-14 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGS 97 WGCCP E A CC+ CCPHD+P+C+ +GTCL+SKNNPFGVK L+R+ AK G+ Sbjct: 402 WGCCPLEGATCCDDHYSCCPHDYPICNTYAGTCLRSKNNPFGVKALRRTPAKPHGA 457 >ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata] gi|297339874|gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata] Length = 455 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + SQ R Sbjct: 393 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGR 451 >dbj|BAH20390.1| AT1G47128 [Arabidopsis thaliana] Length = 178 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + SQ R Sbjct: 116 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGR 174 >dbj|BAE98640.1| cysteine proteinase RD21A [Arabidopsis thaliana] Length = 202 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + SQ R Sbjct: 140 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGR 198 >emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris] Length = 455 Score = 84.3 bits (207), Expect = 2e-14 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 1/56 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGS 97 WGCCP E A CC+ CCPHD+P+C+ +GTCL+SKNNPFGVK L+R+ AK G+ Sbjct: 391 WGCCPLEGATCCDDHYSCCPHDYPICNTYAGTCLRSKNNPFGVKALRRTPAKPHGA 446 >gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana] gi|19548039|gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana] Length = 462 Score = 84.3 bits (207), Expect = 2e-14 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD D GTCL SKN+PF VK LKR A + SQ R Sbjct: 400 WGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGR 458 >gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis] Length = 476 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHA 112 WGCCP ESA CC+ CCPHD+PVCD D+GTC SK+NPFGVK LKR+ A Sbjct: 410 WGCCPLESATCCDDHYSCCPHDYPVCDLDAGTCRVSKDNPFGVKALKRAPA 460 >ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula] gi|355492134|gb|AES73337.1| Cysteine proteinase [Medicago truncatula] Length = 474 Score = 83.2 bits (204), Expect = 3e-14 Identities = 34/63 (53%), Positives = 48/63 (76%), Gaps = 4/63 (6%) Frame = -3 Query: 261 WGCCPPESAICC-EQGDCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAK-RW--GSQ 94 WGCCP E+A+CC + CCPH++P+C+ GTCL+SK+NPFGVK +KR+ AK W G Q Sbjct: 409 WGCCPLEAAVCCKDHSSCCPHNYPICNTRQGTCLRSKDNPFGVKAMKRTPAKLHWPFGDQ 468 Query: 93 SRL 85 +++ Sbjct: 469 NKI 471 >gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis] Length = 463 Score = 82.4 bits (202), Expect = 6e-14 Identities = 33/52 (63%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQ-GDCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAK 109 WGCCP E+A CCE CCPHD+P+C+ ++GTCL SK+NP GVK LKR+ AK Sbjct: 398 WGCCPLEAATCCEDHNSCCPHDYPICNINAGTCLMSKDNPLGVKALKRTAAK 449 >ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa] gi|550331427|gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa] Length = 477 Score = 82.0 bits (201), Expect = 7e-14 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQ-GDCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAK 109 WGCCP ESA CC+ CCPH++PVCD ++GTC SKNNPFGVK L R+ A+ Sbjct: 406 WGCCPLESATCCDDHNSCCPHEYPVCDLEAGTCRMSKNNPFGVKALTRAPAR 457 >ref|XP_006855225.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda] gi|548858978|gb|ERN16692.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda] Length = 538 Score = 82.0 bits (201), Expect = 7e-14 Identities = 33/52 (63%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -3 Query: 261 WGCCPPESAICC-EQGDCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAK 109 WGCCP E+A CC + CCPHD+P+C+ ++GTCL SKN+PFGVK LKR+ AK Sbjct: 472 WGCCPLEAATCCADHYSCCPHDYPICNLNAGTCLASKNSPFGVKALKRTPAK 523 >gb|AEQ61829.1| cysteine protease [Dimocarpus longan] Length = 136 Score = 82.0 bits (201), Expect = 7e-14 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHA 112 WGCCP ESA CC+ CCPHD+PVC+ D GTCL SKNNP GVK L+R+ A Sbjct: 71 WGCCPLESATCCDDHYSCCPHDYPVCNIDEGTCLTSKNNPLGVKALRRTPA 121 >gb|AED99251.1| cysteine protease [Dimocarpus longan] Length = 123 Score = 82.0 bits (201), Expect = 7e-14 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHA 112 WGCCP ESA CC+ CCPHD+PVC+ D GTCL SKNNP GVK L+R+ A Sbjct: 58 WGCCPLESATCCDDHYSCCPHDYPVCNIDEGTCLTSKNNPLGVKALRRTPA 108 >ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis thaliana] gi|9757832|dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|17065064|gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|21387153|gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|332007522|gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis thaliana] Length = 463 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQGD-CCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD + GTCL SKN+PF VK LKR+ A + ++SR Sbjct: 401 WGCCPLEAATCCDDNSSCCPHEYPVCDVNRGTCLMSKNSPFSVKALKRTPAIPFWAKSR 459 >gb|AAC49455.1| Pseudotzain [Pseudotsuga menziesii] Length = 454 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQG-DCCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQS 91 WGCCP SA CC+ CCP DHPVCD D+ TCL+S+ +PFG KMLKR+ AK + S S Sbjct: 396 WGCCPLNSATCCDDHYSCCPSDHPVCDLDAQTCLKSRKDPFGTKMLKRTPAKPYWSLS 453 >dbj|BAF01762.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] Length = 300 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = -3 Query: 261 WGCCPPESAICCEQGD-CCPHDHPVCDNDSGTCLQSKNNPFGVKMLKRSHAKRWGSQSR 88 WGCCP E+A CC+ CCPH++PVCD + GTCL SKN+PF VK LKR+ A + ++SR Sbjct: 238 WGCCPLEAATCCDDNSSCCPHEYPVCDVNRGTCLMSKNSPFSVKALKRTPAIPFWAKSR 296