BLASTX nr result
ID: Ephedra27_contig00007376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00007376 (594 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22921.1| unknown [Picea sitchensis] 71 3e-10 ref|XP_006849772.1| hypothetical protein AMTR_s00024p00252900 [A... 63 7e-08 >gb|ABK22921.1| unknown [Picea sitchensis] Length = 229 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 594 SLISAVSKKNLDMSKSAFVTSADALEDWSTLTGLTGQIKGL 472 SLISAVSKKNLD+SKSAFV+SADALEDWS LTGL+ Q+KGL Sbjct: 189 SLISAVSKKNLDLSKSAFVSSADALEDWSALTGLSEQLKGL 229 >ref|XP_006849772.1| hypothetical protein AMTR_s00024p00252900 [Amborella trichopoda] gi|548853347|gb|ERN11353.1| hypothetical protein AMTR_s00024p00252900 [Amborella trichopoda] Length = 262 Score = 62.8 bits (151), Expect = 7e-08 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 594 SLISAVSKKNLDMSKSAFVTSADALEDWSTLTGLTGQIKGL 472 SLIS+VSK++LD SK AFV+SA ALE W++LTGLTGQ+KGL Sbjct: 222 SLISSVSKRDLDSSKGAFVSSASALEKWTSLTGLTGQLKGL 262