BLASTX nr result
ID: Ephedra27_contig00007172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00007172 (405 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006853840.1| hypothetical protein AMTR_s00036p00069860 [A... 60 4e-07 >ref|XP_006853840.1| hypothetical protein AMTR_s00036p00069860 [Amborella trichopoda] gi|548857508|gb|ERN15307.1| hypothetical protein AMTR_s00036p00069860 [Amborella trichopoda] Length = 96 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/60 (50%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +3 Query: 228 DNQEGGVQSE-ELFTLLRELGGLQVRLSSLMDKMGSLPIDLIRDMRLEIVEVTHQLRNIN 404 D+ E ++ + EL LL+EL LQ R++ LM+K+G+LP+++IRDMR E++EVT QLR +N Sbjct: 32 DDDERRIEIDGELGALLQELSHLQSRMAVLMEKIGTLPLEIIRDMREEVLEVTDQLRTLN 91