BLASTX nr result
ID: Ephedra27_contig00006854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00006854 (456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB94589.1| Xyloglucan endotransglucosylase/hydrolase protein... 59 7e-07 >gb|EXB94589.1| Xyloglucan endotransglucosylase/hydrolase protein 22 [Morus notabilis] Length = 305 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = +3 Query: 24 DRCIDWGKMFFLHKTYSELRGAQIKSKEEFLFMKTSVMLKLIPGNSAGTITAFYLSLESE 203 DRC L T E+ G+ +SK+E+L+ K + +KL+PGNSAGT+TAFYLS + + Sbjct: 49 DRCKILNNGQLLTVTLDEVSGSGFESKDEYLYAKIEMDIKLVPGNSAGTVTAFYLSSKGQ 108 Query: 204 Y 206 Y Sbjct: 109 Y 109