BLASTX nr result
ID: Ephedra27_contig00006687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00006687 (686 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002460581.1| hypothetical protein SORBIDRAFT_02g031210 [S... 60 5e-07 gb|ESW29890.1| hypothetical protein PHAVU_002G106900g [Phaseolus... 60 6e-07 ref|XP_004232506.1| PREDICTED: uncharacterized protein LOC101264... 60 6e-07 ref|XP_003578529.1| PREDICTED: uncharacterized protein LOC100833... 60 6e-07 ref|XP_006660902.1| PREDICTED: uncharacterized protein LOC102703... 60 8e-07 ref|XP_006603964.1| PREDICTED: uncharacterized protein LOC102664... 60 8e-07 ref|XP_006573547.1| PREDICTED: uncharacterized protein LOC102662... 60 8e-07 ref|XP_004957489.1| PREDICTED: uncharacterized protein LOC101781... 60 8e-07 dbj|BAD34385.1| hypothetical protein [Oryza sativa Japonica Grou... 60 8e-07 tpg|DAA64346.1| TPA: hypothetical protein ZEAMMB73_398613 [Zea m... 60 8e-07 ref|NP_001175961.1| Os09g0538750 [Oryza sativa Japonica Group] g... 60 8e-07 gb|EEE70131.1| hypothetical protein OsJ_30161 [Oryza sativa Japo... 60 8e-07 ref|NP_001146678.1| uncharacterized protein LOC100280278 [Zea ma... 60 8e-07 gb|EEC84963.1| hypothetical protein OsI_32200 [Oryza sativa Indi... 60 8e-07 gb|EMT28305.1| hypothetical protein F775_06020 [Aegilops tauschii] 59 1e-06 ref|XP_006340943.1| PREDICTED: uncharacterized protein LOC102600... 59 1e-06 ref|XP_006403933.1| hypothetical protein EUTSA_v10010132mg [Eutr... 59 1e-06 ref|XP_006290733.1| hypothetical protein CARUB_v10016827mg [Caps... 59 1e-06 ref|XP_002265051.2| PREDICTED: uncharacterized protein LOC100245... 59 1e-06 ref|NP_001190052.1| uncharacterized protein [Arabidopsis thalian... 59 1e-06 >ref|XP_002460581.1| hypothetical protein SORBIDRAFT_02g031210 [Sorghum bicolor] gi|241923958|gb|EER97102.1| hypothetical protein SORBIDRAFT_02g031210 [Sorghum bicolor] Length = 666 Score = 60.5 bits (145), Expect = 5e-07 Identities = 23/51 (45%), Positives = 39/51 (76%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSR 153 ++++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN R Sbjct: 603 EEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKR 653 >gb|ESW29890.1| hypothetical protein PHAVU_002G106900g [Phaseolus vulgaris] Length = 646 Score = 60.1 bits (144), Expect = 6e-07 Identities = 21/60 (35%), Positives = 42/60 (70%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQYSKK 180 ++++ Y +++ VT+ +TLNN+Q P +FQ I GFS +C+ FE +YN++++ +++ K Sbjct: 583 EEKSKYEKAVNVTRAMTLNNLQMGCPHVFQGIVGFSSVCMEVFESVYNKAKVAEQEHDVK 642 >ref|XP_004232506.1| PREDICTED: uncharacterized protein LOC101264882 [Solanum lycopersicum] Length = 792 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/57 (38%), Positives = 42/57 (73%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQY 171 D++A Y +++ VT+ +TLNN+Q LP +FQA++GF+ + +FE +YN+++ ++ Y Sbjct: 574 DEKAKYDKAVSVTRAMTLNNLQMGLPHVFQAVTGFANVWTHAFESVYNQAKNTDQDY 630 >ref|XP_003578529.1| PREDICTED: uncharacterized protein LOC100833837 [Brachypodium distachyon] Length = 646 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/51 (43%), Positives = 39/51 (76%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSR 153 ++++ Y +S+ VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN R Sbjct: 583 EEKSKYQKSVGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKR 633 >ref|XP_006660902.1| PREDICTED: uncharacterized protein LOC102703332 [Oryza brachyantha] Length = 392 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/48 (45%), Positives = 38/48 (79%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYN 144 ++++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN Sbjct: 330 EEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYN 377 >ref|XP_006603964.1| PREDICTED: uncharacterized protein LOC102664706 [Glycine max] Length = 259 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/60 (36%), Positives = 42/60 (70%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQYSKK 180 ++++ Y++S+ VT+ +TLNN+Q P +FQ I GFS +C+ FE +YN+++ +++ K Sbjct: 196 EEKSKYNKSVSVTRAMTLNNLQMGCPHVFQGIVGFSSVCMEVFESVYNKAKASEQEHDVK 255 >ref|XP_006573547.1| PREDICTED: uncharacterized protein LOC102662030 [Glycine max] Length = 625 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/60 (36%), Positives = 41/60 (68%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQYSKK 180 ++++ Y +S+ VT+ +TLNN+Q P +FQ I GFS +C+ FE +YN+++ +++ K Sbjct: 562 EEKSKYEKSVSVTRAMTLNNLQMGCPHVFQGIVGFSSVCMEVFESVYNKAKAAEQEHDVK 621 >ref|XP_004957489.1| PREDICTED: uncharacterized protein LOC101781416 [Setaria italica] Length = 660 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/51 (45%), Positives = 40/51 (78%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSR 153 ++++ Y +SI VT+ +TLNN+QT LP +FQA++GF+ +C+ +F+ +YN R Sbjct: 597 EEKSKYEKSIGVTRAMTLNNLQTGLPNVFQAMTGFASVCMEAFQMVYNFKR 647 >dbj|BAD34385.1| hypothetical protein [Oryza sativa Japonica Group] gi|52076050|dbj|BAD46563.1| hypothetical protein [Oryza sativa Japonica Group] Length = 242 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/48 (45%), Positives = 38/48 (79%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYN 144 ++++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN Sbjct: 180 EEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYN 227 >tpg|DAA64346.1| TPA: hypothetical protein ZEAMMB73_398613 [Zea mays] Length = 642 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/51 (45%), Positives = 38/51 (74%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSR 153 +++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN R Sbjct: 583 EEKIKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKR 633 >ref|NP_001175961.1| Os09g0538750 [Oryza sativa Japonica Group] gi|255679095|dbj|BAH94689.1| Os09g0538750 [Oryza sativa Japonica Group] Length = 365 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/48 (45%), Positives = 38/48 (79%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYN 144 ++++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN Sbjct: 303 EEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYN 350 >gb|EEE70131.1| hypothetical protein OsJ_30161 [Oryza sativa Japonica Group] Length = 544 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/48 (45%), Positives = 38/48 (79%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYN 144 ++++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN Sbjct: 482 EEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYN 529 >ref|NP_001146678.1| uncharacterized protein LOC100280278 [Zea mays] gi|219888273|gb|ACL54511.1| unknown [Zea mays] gi|414888331|tpg|DAA64345.1| TPA: hypothetical protein ZEAMMB73_398613 [Zea mays] Length = 573 Score = 59.7 bits (143), Expect = 8e-07 Identities = 23/51 (45%), Positives = 38/51 (74%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSR 153 +++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN R Sbjct: 514 EEKIKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKR 564 >gb|EEC84963.1| hypothetical protein OsI_32200 [Oryza sativa Indica Group] Length = 670 Score = 59.7 bits (143), Expect = 8e-07 Identities = 22/48 (45%), Positives = 38/48 (79%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYN 144 ++++ Y +SI VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN Sbjct: 608 EEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYN 655 >gb|EMT28305.1| hypothetical protein F775_06020 [Aegilops tauschii] Length = 557 Score = 59.3 bits (142), Expect = 1e-06 Identities = 22/51 (43%), Positives = 38/51 (74%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSR 153 D++ + +S+ VT+ +TLNN+QT P +FQA++GF+ +C+ +FE +YN R Sbjct: 494 DEKTKHEKSVGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESVYNFKR 544 >ref|XP_006340943.1| PREDICTED: uncharacterized protein LOC102600978 [Solanum tuberosum] Length = 591 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/60 (36%), Positives = 43/60 (71%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQYSKK 180 D++A Y +++ VT+ +TLNN+Q LP +FQA++GF+ + +FE +YN+++ ++ + K Sbjct: 528 DEKAKYDKAVSVTRAMTLNNLQMGLPHVFQAVTGFANVWTHAFESVYNQAKNTDQVHEMK 587 >ref|XP_006403933.1| hypothetical protein EUTSA_v10010132mg [Eutrema salsugineum] gi|557105052|gb|ESQ45386.1| hypothetical protein EUTSA_v10010132mg [Eutrema salsugineum] Length = 801 Score = 58.9 bits (141), Expect = 1e-06 Identities = 20/56 (35%), Positives = 43/56 (76%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQ 168 ++++ + +++ VT+ +TLNN+Q P +FQA+ GFS +C+++FE +YN+++ + E+ Sbjct: 579 EEKSKHEKAVSVTRAMTLNNLQMGFPHVFQAMVGFSSVCMQAFESVYNQAKCIGEE 634 >ref|XP_006290733.1| hypothetical protein CARUB_v10016827mg [Capsella rubella] gi|482559440|gb|EOA23631.1| hypothetical protein CARUB_v10016827mg [Capsella rubella] Length = 640 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/55 (38%), Positives = 42/55 (76%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNE 165 ++++ + +S+ VT+ +TLNN+Q P +FQA+ GFS +C+++FE +YN+++ + E Sbjct: 576 EEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVCMQAFESVYNQAKSIGE 630 >ref|XP_002265051.2| PREDICTED: uncharacterized protein LOC100245548 [Vitis vinifera] Length = 1169 Score = 58.9 bits (141), Expect = 1e-06 Identities = 19/60 (31%), Positives = 44/60 (73%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNEQYSKK 180 ++++ + +++ VT+ VTLNN+Q P +FQA++GF+ +C +FE ++N+++ ++++ K Sbjct: 1106 EEKSKHEKAVSVTRSVTLNNLQMGFPHVFQAVTGFASVCTHAFESVHNQAKCMDQELDVK 1165 >ref|NP_001190052.1| uncharacterized protein [Arabidopsis thaliana] gi|332645254|gb|AEE78775.1| uncharacterized protein AT3G51290 [Arabidopsis thaliana] Length = 798 Score = 58.9 bits (141), Expect = 1e-06 Identities = 21/55 (38%), Positives = 42/55 (76%) Frame = +1 Query: 1 DQEANYSRSIQVTKDVTLNNIQTALPGLFQAISGFSEICVRSFEDIYNRSRILNE 165 ++++ + +S+ VT+ +TLNN+Q P +FQA+ GFS +C+++FE +YN+++ + E Sbjct: 576 EEKSKHEKSVSVTRAMTLNNLQMGFPHVFQAMVGFSSVCMQAFESVYNQAKSIGE 630