BLASTX nr result
ID: Ephedra27_contig00006614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00006614 (433 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG69686.1| hypothetical protein 2_3222_02, partial [Pinus ta... 58 2e-06 gb|AFG69692.1| hypothetical protein 2_3222_02, partial [Pinus ta... 55 7e-06 >gb|AFG69686.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172641|gb|AFG69687.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172643|gb|AFG69688.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172645|gb|AFG69689.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172647|gb|AFG69690.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172649|gb|AFG69691.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172653|gb|AFG69693.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172655|gb|AFG69694.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172657|gb|AFG69695.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172659|gb|AFG69696.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172661|gb|AFG69697.1| hypothetical protein 2_3222_02, partial [Pinus taeda] gi|383172663|gb|AFG69698.1| hypothetical protein 2_3222_02, partial [Pinus taeda] Length = 88 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 6/75 (8%) Frame = -2 Query: 432 VRDIIKVLEELDTLPPKVVKEVTAAMVQKNPEIAEQEPRDIKVEANNAVNGV------VS 271 VRDI KVL+ELD LPPK+V+EVT ++ + +PE+ E++ K+++++ + + V Sbjct: 15 VRDIEKVLQELDALPPKLVREVTVSLAESHPELKEKDIDTAKLKSSDVFHEILNSQKAVK 74 Query: 270 KWKSLTRMQSSNRIC 226 WK Q NRIC Sbjct: 75 AWKKFV-AQKPNRIC 88 >gb|AFG69692.1| hypothetical protein 2_3222_02, partial [Pinus taeda] Length = 88 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 6/75 (8%) Frame = -2 Query: 432 VRDIIKVLEELDTLPPKVVKEVTAAMVQKNPEIAEQEPRDIKVEANNAVNGV------VS 271 VRDI KVL+ELD LPPK+V+EV ++ + +PE+ E++ K+++++ + + V Sbjct: 15 VRDIEKVLQELDALPPKLVREVMVSLAESHPELKEKDIDTAKLKSSDVFHEILNSQKAVK 74 Query: 270 KWKSLTRMQSSNRIC 226 WK Q NRIC Sbjct: 75 AWKKFV-AQKPNRIC 88