BLASTX nr result
ID: Ephedra27_contig00006312
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00006312 (445 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC49004.1| phosphoribosylanthranilate isomerase [Arabidopsis... 55 1e-05 >gb|AAC49004.1| phosphoribosylanthranilate isomerase [Arabidopsis thaliana] Length = 275 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/39 (58%), Positives = 34/39 (87%) Frame = -3 Query: 443 ALTLLQPEAVDVSSGICGLDGIQKDPTLITSFMNSVQHI 327 AL++LQP+ +DVSSGICG+DGIQKD + I+SF+ +V+ + Sbjct: 235 ALSILQPDGIDVSSGICGIDGIQKDKSKISSFITAVRSV 273