BLASTX nr result
ID: Ephedra27_contig00006275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00006275 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB43803.1| Calcium-transporting ATPase 1 [Morus notabilis] 88 1e-15 ref|XP_006664154.1| PREDICTED: calcium-transporting ATPase 1, pl... 88 1e-15 gb|EMT07278.1| Calcium-transporting ATPase 1, plasma membrane-ty... 88 1e-15 gb|EMS56544.1| Calcium-transporting ATPase 1, plasma membrane-ty... 88 1e-15 ref|NP_001067159.1| Os12g0586600 [Oryza sativa Japonica Group] g... 88 1e-15 gb|EAY83696.1| hypothetical protein OsI_38919 [Oryza sativa Indi... 88 1e-15 ref|XP_006415726.1| hypothetical protein EUTSA_v10006664mg [Eutr... 87 2e-15 ref|XP_006849321.1| hypothetical protein AMTR_s00164p00023490 [A... 87 2e-15 ref|XP_002320033.1| azetidine-2-carboxylic acid resistant 1 fami... 87 2e-15 ref|XP_006472295.1| PREDICTED: calcium-transporting ATPase 1, ch... 87 3e-15 ref|XP_004501522.1| PREDICTED: calcium-transporting ATPase 1, ch... 87 3e-15 ref|XP_004501521.1| PREDICTED: calcium-transporting ATPase 1, ch... 87 3e-15 ref|XP_006306641.1| hypothetical protein CARUB_v10008156mg [Caps... 87 3e-15 ref|XP_003611588.1| Calcium-transporting ATPase 2, plasma membra... 86 4e-15 emb|CBI19406.3| unnamed protein product [Vitis vinifera] 86 4e-15 ref|XP_002285297.1| PREDICTED: calcium-transporting ATPase 1, ch... 86 4e-15 gb|AAM44081.1| type IIB calcium ATPase MCA5 [Medicago truncatula] 86 4e-15 ref|XP_004509067.1| PREDICTED: calcium-transporting ATPase 2, pl... 86 5e-15 tpg|DAA47293.1| TPA: hypothetical protein ZEAMMB73_538388, parti... 86 5e-15 dbj|BAA03090.1| chloroplast envelope Ca2+-ATPase precursor [Arab... 86 7e-15 >gb|EXB43803.1| Calcium-transporting ATPase 1 [Morus notabilis] Length = 889 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLNENFG VKAKNSSEEAL RWR LC VVKN+KRRFRFTANL KR+E Sbjct: 1 MESYLNENFGDVKAKNSSEEALQRWRKLCWVVKNRKRRFRFTANLDKRNE 50 >ref|XP_006664154.1| PREDICTED: calcium-transporting ATPase 1, plasma membrane-type-like [Oryza brachyantha] Length = 1020 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YL ENFGGVKAKNSSEEAL RWR LC VVKN KRRFRFTANL KR E Sbjct: 1 MESYLEENFGGVKAKNSSEEALRRWRKLCGVVKNPKRRFRFTANLDKRGE 50 >gb|EMT07278.1| Calcium-transporting ATPase 1, plasma membrane-type [Aegilops tauschii] Length = 1042 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YL ENFGGVK KNSSEEAL RWR LCSVVKN KRRFRFTANL KR E Sbjct: 1 MESYLEENFGGVKGKNSSEEALRRWRKLCSVVKNPKRRFRFTANLDKRGE 50 >gb|EMS56544.1| Calcium-transporting ATPase 1, plasma membrane-type [Triticum urartu] Length = 946 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YL ENFGGVK KNSSEEAL RWR LCSVVKN KRRFRFTANL KR E Sbjct: 1 MESYLEENFGGVKGKNSSEEALRRWRKLCSVVKNPKRRFRFTANLDKRGE 50 >ref|NP_001067159.1| Os12g0586600 [Oryza sativa Japonica Group] gi|110832727|sp|Q2QMX9.1|ACA1_ORYSJ RecName: Full=Calcium-transporting ATPase 1, plasma membrane-type; AltName: Full=Ca(2+)-ATPase isoform 1; AltName: Full=Plastid envelope ATPase 1 gi|77556940|gb|ABA99736.1| Calcium-transporting ATPase 2, plasma membrane-type, putative, expressed [Oryza sativa Japonica Group] gi|113649666|dbj|BAF30178.1| Os12g0586600 [Oryza sativa Japonica Group] gi|125579892|gb|EAZ21038.1| hypothetical protein OsJ_36685 [Oryza sativa Japonica Group] gi|215694696|dbj|BAG89887.1| unnamed protein product [Oryza sativa Japonica Group] Length = 1020 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YL ENFGGVKAKNSSEEAL RWR LC VVKN KRRFRFTANL KR E Sbjct: 1 MESYLEENFGGVKAKNSSEEALRRWRKLCGVVKNPKRRFRFTANLDKRGE 50 >gb|EAY83696.1| hypothetical protein OsI_38919 [Oryza sativa Indica Group] Length = 1020 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YL ENFGGVKAKNSSEEAL RWR LC VVKN KRRFRFTANL KR E Sbjct: 1 MESYLEENFGGVKAKNSSEEALRRWRKLCGVVKNPKRRFRFTANLDKRGE 50 >ref|XP_006415726.1| hypothetical protein EUTSA_v10006664mg [Eutrema salsugineum] gi|567147192|ref|XP_006415727.1| hypothetical protein EUTSA_v10006664mg [Eutrema salsugineum] gi|557093497|gb|ESQ34079.1| hypothetical protein EUTSA_v10006664mg [Eutrema salsugineum] gi|557093498|gb|ESQ34080.1| hypothetical protein EUTSA_v10006664mg [Eutrema salsugineum] Length = 1020 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 MENYLNENFG VK KNSS+EAL RWR LC +VKN KRRFRFTANL+KRSE Sbjct: 1 MENYLNENFGDVKPKNSSDEALQRWRKLCWIVKNPKRRFRFTANLSKRSE 50 >ref|XP_006849321.1| hypothetical protein AMTR_s00164p00023490 [Amborella trichopoda] gi|548852842|gb|ERN10902.1| hypothetical protein AMTR_s00164p00023490 [Amborella trichopoda] Length = 1018 Score = 87.4 bits (215), Expect = 2e-15 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLNENFGGV+ K+SSEEAL RWR LC +VKN KRRFRFTANL+KRSE Sbjct: 1 MESYLNENFGGVRPKHSSEEALRRWRRLCGIVKNPKRRFRFTANLSKRSE 50 >ref|XP_002320033.1| azetidine-2-carboxylic acid resistant 1 family protein [Populus trichocarpa] gi|222860806|gb|EEE98348.1| azetidine-2-carboxylic acid resistant 1 family protein [Populus trichocarpa] Length = 1020 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 MENYLNENFG VKAKNSS+EAL RWR LC +VKN+KRRFRFTANL+KR E Sbjct: 1 MENYLNENFGDVKAKNSSDEALQRWRKLCWLVKNRKRRFRFTANLSKRFE 50 >ref|XP_006472295.1| PREDICTED: calcium-transporting ATPase 1, chloroplastic-like isoform X1 [Citrus sinensis] gi|568836534|ref|XP_006472296.1| PREDICTED: calcium-transporting ATPase 1, chloroplastic-like isoform X2 [Citrus sinensis] Length = 1018 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 MENYLNENF VKAKN+SEEAL RWR LC VKNKKRRFRFTANL+KR E Sbjct: 1 MENYLNENFSDVKAKNTSEEALQRWRKLCGFVKNKKRRFRFTANLSKRFE 50 >ref|XP_004501522.1| PREDICTED: calcium-transporting ATPase 1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 966 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLNENFG VK+KNSSEEAL RWR LC VVKN+KRRFRFTANL+KR E Sbjct: 1 MESYLNENFGDVKSKNSSEEALQRWRKLCWVVKNRKRRFRFTANLSKRFE 50 >ref|XP_004501521.1| PREDICTED: calcium-transporting ATPase 1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 1019 Score = 86.7 bits (213), Expect = 3e-15 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLNENFG VK+KNSSEEAL RWR LC VVKN+KRRFRFTANL+KR E Sbjct: 1 MESYLNENFGDVKSKNSSEEALQRWRKLCWVVKNRKRRFRFTANLSKRFE 50 >ref|XP_006306641.1| hypothetical protein CARUB_v10008156mg [Capsella rubella] gi|482575352|gb|EOA39539.1| hypothetical protein CARUB_v10008156mg [Capsella rubella] Length = 1069 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = +2 Query: 203 FVRMENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 + +ME+YLNENFG VK KNSS+EAL RWR LC +VKN KRRFRFTANL+KRSE Sbjct: 47 YKKMESYLNENFGDVKPKNSSDEALQRWRKLCWIVKNPKRRFRFTANLSKRSE 99 >ref|XP_003611588.1| Calcium-transporting ATPase 2, plasma membrane-type [Medicago truncatula] gi|355512923|gb|AES94546.1| Calcium-transporting ATPase 2, plasma membrane-type [Medicago truncatula] Length = 1039 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 MENYL ENFGGVK+KNSSEEAL RWR++C VKN KRRFRFTANL KR E Sbjct: 1 MENYLQENFGGVKSKNSSEEALRRWRDVCGFVKNPKRRFRFTANLDKRGE 50 >emb|CBI19406.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLN+NFGGVK KNSSEEAL RWR LC VVKN KRRFRFTANL+KR E Sbjct: 1 MESYLNDNFGGVKPKNSSEEALQRWRKLCWVVKNPKRRFRFTANLSKRFE 50 >ref|XP_002285297.1| PREDICTED: calcium-transporting ATPase 1, chloroplastic-like [Vitis vinifera] Length = 1018 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLN+NFGGVK KNSSEEAL RWR LC VVKN KRRFRFTANL+KR E Sbjct: 1 MESYLNDNFGGVKPKNSSEEALQRWRKLCWVVKNPKRRFRFTANLSKRFE 50 >gb|AAM44081.1| type IIB calcium ATPase MCA5 [Medicago truncatula] Length = 1014 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 MENYL ENFGGVK+KNSSEEAL RWR++C VKN KRRFRFTANL KR E Sbjct: 1 MENYLQENFGGVKSKNSSEEALRRWRDVCGFVKNPKRRFRFTANLDKRGE 50 >ref|XP_004509067.1| PREDICTED: calcium-transporting ATPase 2, plasma membrane-type-like [Cicer arietinum] Length = 1014 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLNENFGGVK+KNS+EEAL +WR LC VVKN KRRFRFTAN++KR E Sbjct: 1 MESYLNENFGGVKSKNSTEEALGKWRKLCGVVKNPKRRFRFTANISKRYE 50 >tpg|DAA47293.1| TPA: hypothetical protein ZEAMMB73_538388, partial [Zea mays] Length = 539 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YL E FGGV+AKNSSEEAL RWR LCSVVKN KRRFRFTANL KR E Sbjct: 1 MESYLEERFGGVQAKNSSEEALRRWRRLCSVVKNPKRRFRFTANLEKRGE 50 >dbj|BAA03090.1| chloroplast envelope Ca2+-ATPase precursor [Arabidopsis thaliana] gi|4176435|emb|CAA49559.1| envelope Ca2+-ATPase [Arabidopsis thaliana] Length = 946 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +2 Query: 212 MENYLNENFGGVKAKNSSEEALTRWRNLCSVVKNKKRRFRFTANLTKRSE 361 ME+YLNENFG VK KNSS+EAL RWR LC +VKN KRRFRFTANL+KRSE Sbjct: 1 MESYLNENFGDVKPKNSSDEALQRWRKLCWIVKNPKRRFRFTANLSKRSE 50