BLASTX nr result
ID: Ephedra27_contig00005874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00005874 (527 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367022.1| PREDICTED: putative RING-H2 finger protein A... 64 3e-08 gb|EOY19298.1| RING/U-box superfamily protein [Theobroma cacao] 64 3e-08 ref|XP_004236803.1| PREDICTED: putative RING-H2 finger protein A... 64 3e-08 gb|EPS60936.1| hypothetical protein M569_13867, partial [Genlise... 62 6e-08 ref|XP_002269714.1| PREDICTED: RING-H2 finger protein ATL70-like... 62 8e-08 emb|CAN70851.1| hypothetical protein VITISV_030130 [Vitis vinifera] 62 8e-08 gb|EAZ28842.1| hypothetical protein OsJ_12875 [Oryza sativa Japo... 62 8e-08 ref|NP_001051499.1| Os03g0788100 [Oryza sativa Japonica Group] g... 62 8e-08 gb|EXC12979.1| RING-H2 finger protein ATL70 [Morus notabilis] 62 1e-07 gb|EMS67322.1| Putative RING-H2 finger protein ATL71 [Triticum u... 62 1e-07 ref|XP_003559350.1| PREDICTED: putative RING-H2 finger protein A... 62 1e-07 ref|XP_002459363.1| hypothetical protein SORBIDRAFT_02g003340 [S... 62 1e-07 gb|EEC76299.1| hypothetical protein OsI_13817 [Oryza sativa Indi... 62 1e-07 gb|EPS63693.1| hypothetical protein M569_11092, partial [Genlise... 61 1e-07 ref|XP_004143342.1| PREDICTED: putative RING-H2 finger protein A... 61 1e-07 ref|XP_003577735.1| PREDICTED: RING-H2 finger protein ATL65-like... 61 1e-07 ref|XP_002524078.1| ring finger protein, putative [Ricinus commu... 61 1e-07 ref|XP_004496297.1| PREDICTED: RING-H2 finger protein ATL70-like... 61 2e-07 ref|NP_001146387.1| uncharacterized LOC100279967 [Zea mays] gi|2... 61 2e-07 ref|XP_004981503.1| PREDICTED: putative RING-H2 finger protein A... 60 2e-07 >ref|XP_006367022.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Solanum tuberosum] Length = 179 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 526 EYADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 +Y D D++R + CGHIFHV C+DPWLR+H TCP+CR S Sbjct: 136 DYKDN-DMLRLLSNCGHIFHVKCIDPWLRLHPTCPICRNS 174 >gb|EOY19298.1| RING/U-box superfamily protein [Theobroma cacao] Length = 162 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 526 EYADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 EY D D++R + CGHIFH+ CVDPWLR+H TCP+CR S Sbjct: 105 EYKD-TDMLRLLPDCGHIFHLKCVDPWLRLHPTCPICRNS 143 >ref|XP_004236803.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Solanum lycopersicum] Length = 186 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 526 EYADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 +Y D D++R + CGHIFHV C+DPWLR+H TCP+CR S Sbjct: 143 DYKDN-DMLRLLSNCGHIFHVKCIDPWLRLHPTCPICRNS 181 >gb|EPS60936.1| hypothetical protein M569_13867, partial [Genlisea aurea] Length = 140 Score = 62.4 bits (150), Expect = 6e-08 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -2 Query: 508 DIVRAMEVCGHIFHVDCVDPWLRIHATCPVCR 413 D++R + CGH+FHV C+DPWLR+H TCPVCR Sbjct: 92 DVIRRLPKCGHLFHVTCIDPWLRLHPTCPVCR 123 >ref|XP_002269714.1| PREDICTED: RING-H2 finger protein ATL70-like [Vitis vinifera] Length = 169 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 514 GVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 G D++R + CGH+FH+ CVDPWLR+H TCPVCR S Sbjct: 113 GSDMLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTS 148 >emb|CAN70851.1| hypothetical protein VITISV_030130 [Vitis vinifera] Length = 275 Score = 62.0 bits (149), Expect = 8e-08 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -2 Query: 514 GVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 G D++R + CGH+FH+ CVDPWLR+H TCPVCR S Sbjct: 112 GSDMLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTS 147 >gb|EAZ28842.1| hypothetical protein OsJ_12875 [Oryza sativa Japonica Group] Length = 185 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG D++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 126 YGDG-DVLRMLPECGHLFHRECVDPWLRQHPTCPVCRTS 163 >ref|NP_001051499.1| Os03g0788100 [Oryza sativa Japonica Group] gi|50355735|gb|AAT75260.1| putative C3HC4 type RING zinc finger protein [Oryza sativa Japonica Group] gi|108711458|gb|ABF99253.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa Japonica Group] gi|113549970|dbj|BAF13413.1| Os03g0788100 [Oryza sativa Japonica Group] Length = 208 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG D++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 149 YGDG-DVLRMLPECGHLFHRECVDPWLRQHPTCPVCRTS 186 >gb|EXC12979.1| RING-H2 finger protein ATL70 [Morus notabilis] Length = 173 Score = 61.6 bits (148), Expect = 1e-07 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -2 Query: 508 DIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 D++R + CGH+FHV CVDPWLR+H TCPVCR S Sbjct: 119 DMLRQLPDCGHLFHVKCVDPWLRLHPTCPVCRTS 152 >gb|EMS67322.1| Putative RING-H2 finger protein ATL71 [Triticum urartu] Length = 142 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG D++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 82 YGDG-DVLRMLPDCGHLFHRECVDPWLRKHPTCPVCRTS 119 >ref|XP_003559350.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Brachypodium distachyon] Length = 204 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG D++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 145 YGDG-DVLRMLPDCGHLFHRECVDPWLRQHPTCPVCRTS 182 >ref|XP_002459363.1| hypothetical protein SORBIDRAFT_02g003340 [Sorghum bicolor] gi|241922740|gb|EER95884.1| hypothetical protein SORBIDRAFT_02g003340 [Sorghum bicolor] Length = 179 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG D+VR + CGH+FH DCVDPWLR TCPVCR S Sbjct: 118 YGDG-DVVRVLPDCGHLFHRDCVDPWLRKRPTCPVCRTS 155 >gb|EEC76299.1| hypothetical protein OsI_13817 [Oryza sativa Indica Group] Length = 195 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG D++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 136 YGDG-DVLRMLPDCGHLFHRECVDPWLRQHPTCPVCRTS 173 >gb|EPS63693.1| hypothetical protein M569_11092, partial [Genlisea aurea] Length = 126 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 508 DIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 D +R + CGH+FH +CVDPWL IHATCPVCR S Sbjct: 87 DALRLLPECGHVFHAECVDPWLLIHATCPVCRKS 120 >ref|XP_004143342.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Cucumis sativus] Length = 172 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 508 DIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 D++R + CGH+FH+ CVDPWLR+H TCPVCR S Sbjct: 118 DVLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTS 151 >ref|XP_003577735.1| PREDICTED: RING-H2 finger protein ATL65-like [Brachypodium distachyon] Length = 435 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -2 Query: 526 EYADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 E+ADG D +RA+ +C H FH DC+D WLR HATCP+CR + Sbjct: 190 EFADG-DELRALPLCAHAFHADCIDVWLRAHATCPLCRAA 228 >ref|XP_002524078.1| ring finger protein, putative [Ricinus communis] gi|223536646|gb|EEF38288.1| ring finger protein, putative [Ricinus communis] Length = 172 Score = 61.2 bits (147), Expect = 1e-07 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -2 Query: 508 DIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 D++R + CGH+FH+ CVDPWLR+H TCPVCR S Sbjct: 118 DMLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRNS 151 >ref|XP_004496297.1| PREDICTED: RING-H2 finger protein ATL70-like [Cicer arietinum] Length = 146 Score = 60.8 bits (146), Expect = 2e-07 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = -2 Query: 508 DIVRAMEVCGHIFHVDCVDPWLRIHATCPVCR 413 D++R + CGH++HV CVDPWLR+H+TCP+CR Sbjct: 110 DVLRLLHDCGHLYHVACVDPWLRLHSTCPICR 141 >ref|NP_001146387.1| uncharacterized LOC100279967 [Zea mays] gi|219886955|gb|ACL53852.1| unknown [Zea mays] gi|414873247|tpg|DAA51804.1| TPA: putative RING zinc finger domain superfamily protein [Zea mays] Length = 198 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG +++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 136 YGDG-EVLRMLPDCGHLFHRECVDPWLRYHPTCPVCRTS 173 >ref|XP_004981503.1| PREDICTED: putative RING-H2 finger protein ATL71-like [Setaria italica] Length = 193 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -2 Query: 523 YADGVDIVRAMEVCGHIFHVDCVDPWLRIHATCPVCRGS 407 Y DG +++R + CGH+FH +CVDPWLR H TCPVCR S Sbjct: 133 YGDG-EVLRMLPECGHLFHRECVDPWLRQHPTCPVCRTS 170