BLASTX nr result
ID: Ephedra27_contig00005619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00005619 (528 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidop... 120 1e-25 gb|ADE75925.1| unknown [Picea sitchensis] 120 1e-25 gb|ACA58350.1| putative 26S proteasome regulatory complex protei... 120 1e-25 ref|XP_006842586.1| hypothetical protein AMTR_s00077p00161980 [A... 119 3e-25 ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6... 119 4e-25 gb|ESW18898.1| hypothetical protein PHAVU_006G080300g [Phaseolus... 119 4e-25 ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citr... 119 4e-25 ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutr... 119 4e-25 ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Pop... 119 4e-25 gb|EOY19210.1| Regulatory particle triple-A ATPase 3 isoform 2, ... 119 4e-25 gb|EOY19209.1| Regulatory particle triple-A ATPase 3 isoform 1 [... 119 4e-25 ref|XP_004242474.1| PREDICTED: 26S protease regulatory subunit 6... 119 4e-25 ref|XP_004242453.1| PREDICTED: 26S protease regulatory subunit 6... 119 4e-25 ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease... 119 4e-25 ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6... 119 4e-25 ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6... 119 4e-25 ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6... 119 4e-25 sp|P85200.1|PRS6B_HELAN RecName: Full=26S protease regulatory su... 119 4e-25 emb|CBI15803.3| unnamed protein product [Vitis vinifera] 119 4e-25 ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative... 119 4e-25 >ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|297793353|ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|565430379|ref|XP_006279634.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] gi|28558168|sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 gi|6652882|gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|8777330|dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|17979231|gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana] gi|56382019|gb|AAV85728.1| At5g58290 [Arabidopsis thaliana] gi|297310396|gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|332009646|gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|482548338|gb|EOA12532.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] Length = 408 Score = 120 bits (302), Expect = 1e-25 Identities = 57/58 (98%), Positives = 58/58 (100%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDF+FYK Sbjct: 351 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >gb|ADE75925.1| unknown [Picea sitchensis] Length = 214 Score = 120 bits (302), Expect = 1e-25 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK Sbjct: 157 EDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 214 >gb|ACA58350.1| putative 26S proteasome regulatory complex protein [Sandersonia aurantiaca] Length = 71 Score = 120 bits (302), Expect = 1e-25 Identities = 57/58 (98%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFDFYK Sbjct: 14 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK 71 >ref|XP_006842586.1| hypothetical protein AMTR_s00077p00161980 [Amborella trichopoda] gi|548844672|gb|ERN04261.1| hypothetical protein AMTR_s00077p00161980 [Amborella trichopoda] Length = 416 Score = 119 bits (299), Expect = 3e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFDFY+ Sbjct: 359 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYR 416 >ref|XP_006464959.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Citrus sinensis] Length = 412 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 355 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 >gb|ESW18898.1| hypothetical protein PHAVU_006G080300g [Phaseolus vulgaris] Length = 420 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 363 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 420 >ref|XP_006432050.1| hypothetical protein CICLE_v10003767mg [Citrus clementina] gi|557534172|gb|ESR45290.1| hypothetical protein CICLE_v10003767mg [Citrus clementina] Length = 395 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 338 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 395 >ref|XP_006401107.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] gi|557102197|gb|ESQ42560.1| hypothetical protein EUTSA_v10013708mg [Eutrema salsugineum] Length = 404 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDF+FYK Sbjct: 347 EDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFEFYK 404 >ref|XP_002307945.2| 26S proteasome subunit 7 family protein [Populus trichocarpa] gi|550335334|gb|EEE91468.2| 26S proteasome subunit 7 family protein [Populus trichocarpa] Length = 384 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 327 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 384 >gb|EOY19210.1| Regulatory particle triple-A ATPase 3 isoform 2, partial [Theobroma cacao] Length = 291 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 234 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 291 >gb|EOY19209.1| Regulatory particle triple-A ATPase 3 isoform 1 [Theobroma cacao] Length = 419 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 362 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 419 >ref|XP_004242474.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum lycopersicum] Length = 414 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 357 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 414 >ref|XP_004242453.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Solanum lycopersicum] Length = 414 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 357 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 414 >ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Length = 418 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 361 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Length = 418 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 361 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6B homolog [Vitis vinifera] Length = 418 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 361 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_003553190.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Glycine max] Length = 422 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 365 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 422 >sp|P85200.1|PRS6B_HELAN RecName: Full=26S protease regulatory subunit 6B homolog Length = 414 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 56/58 (96%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEI AICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDFDFYK Sbjct: 357 EDYVSRPDKISAAEITAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFDFYK 414 >emb|CBI15803.3| unnamed protein product [Vitis vinifera] Length = 328 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 271 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 328 >ref|XP_002523664.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] gi|223537064|gb|EEF38699.1| 26S protease regulatory subunit 6b, putative [Ricinus communis] Length = 415 Score = 119 bits (298), Expect = 4e-25 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = +1 Query: 1 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDFDFYK 174 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYR NVKKPDTDF+FYK Sbjct: 358 EDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415