BLASTX nr result
ID: Ephedra27_contig00005260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00005260 (449 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW08200.1| hypothetical protein 2_2931_01, partial [Pinus la... 57 2e-06 >gb|AEW08200.1| hypothetical protein 2_2931_01, partial [Pinus lambertiana] Length = 151 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +3 Query: 3 HSGNGCPSAFALPGSPLSILQSSVDAKLQAICQRLSQEN 119 +S NG P+ + PG+ LS+L+SSVDAKLQAICQRLSQEN Sbjct: 88 NSDNGSPNVLSPPGNALSVLKSSVDAKLQAICQRLSQEN 126