BLASTX nr result
ID: Ephedra27_contig00004482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00004482 (408 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ22368.1| hypothetical protein PRUPE_ppa021814mg [Prunus pe... 57 3e-06 >gb|EMJ22368.1| hypothetical protein PRUPE_ppa021814mg [Prunus persica] Length = 256 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +3 Query: 42 MKNEEVRIVREQARKVNSALALDSRIEISHLSIGDGLTLCRRLH 173 M E +R R+ R++NS LA DSRIE++H+SIGDGLTLCRR++ Sbjct: 213 MVEEHLRPSRKHTRELNSFLATDSRIELAHVSIGDGLTLCRRIY 256