BLASTX nr result
ID: Ephedra27_contig00004062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00004062 (447 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303789.1| PREDICTED: uncharacterized protein LOC101304... 55 1e-05 >ref|XP_004303789.1| PREDICTED: uncharacterized protein LOC101304983 [Fragaria vesca subsp. vesca] Length = 982 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -2 Query: 434 ERKISRSCSKKKVIANGLLLLGGAVCLTRG-SSIAAKFAVACLVNKILNKHGN 279 ERK+SR SKK ++ANGLLLLGG VCL+RG SS+ AK A+A ++ K LNK G+ Sbjct: 921 ERKLSRRPSKK-LLANGLLLLGGVVCLSRGRSSLGAKVAMAYILTK-LNKRGS 971