BLASTX nr result
ID: Ephedra27_contig00004051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00004051 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGK24944.1| aromatic aminotransferase [Ephedra sinica] 74 3e-11 >gb|AGK24944.1| aromatic aminotransferase [Ephedra sinica] Length = 411 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +3 Query: 3 GMKDWIRISFAAPSTLLEEAWDRIESFCCKTSYL 104 GMKDWIRISFAAPSTLLEEAWDRIESFCC++SYL Sbjct: 378 GMKDWIRISFAAPSTLLEEAWDRIESFCCRSSYL 411