BLASTX nr result
ID: Ephedra27_contig00003913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00003913 (513 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001779929.1| predicted protein [Physcomitrella patens] gi... 84 1e-14 ref|XP_006348049.1| PREDICTED: CDGSH iron-sulfur domain-containi... 83 3e-14 ref|XP_004234151.1| PREDICTED: CDGSH iron-sulfur domain-containi... 83 3e-14 ref|XP_001783842.1| predicted protein [Physcomitrella patens] gi... 82 6e-14 gb|EMJ19796.1| hypothetical protein PRUPE_ppa013339mg [Prunus pe... 81 1e-13 ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containi... 81 2e-13 ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, part... 81 2e-13 ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Popu... 81 2e-13 ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Popu... 81 2e-13 ref|XP_002960535.1| hypothetical protein SELMODRAFT_437606 [Sela... 80 3e-13 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 80 3e-13 ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 80 3e-13 gb|ABK20944.1| unknown [Picea sitchensis] 80 3e-13 gb|AFK46198.1| unknown [Lotus japonicus] 80 4e-13 gb|ESW24382.1| hypothetical protein PHAVU_004G125800g [Phaseolus... 79 5e-13 gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] 79 5e-13 gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [M... 79 6e-13 ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 79 6e-13 ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containi... 79 6e-13 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 79 6e-13 >ref|XP_001779929.1| predicted protein [Physcomitrella patens] gi|162668643|gb|EDQ55246.1| predicted protein [Physcomitrella patens] Length = 86 Score = 84.3 bits (207), Expect = 1e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -3 Query: 373 DDLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 D+LSKP TAYCRCW S+TFPLC+G H KHNKETGDNVGPLLL Sbjct: 43 DELSKPLTAYCRCWRSETFPLCNGAHVKHNKETGDNVGPLLL 84 >ref|XP_006348049.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Solanum tuberosum] Length = 98 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP TAYCRCW S TFPLCDG+H KHNKETGDNVGPLLL Sbjct: 55 ELSKPLTAYCRCWRSGTFPLCDGSHVKHNKETGDNVGPLLL 95 >ref|XP_004234151.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Solanum lycopersicum] Length = 98 Score = 83.2 bits (204), Expect = 3e-14 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP TAYCRCW S TFPLCDG+H KHNKETGDNVGPLLL Sbjct: 55 ELSKPLTAYCRCWRSGTFPLCDGSHVKHNKETGDNVGPLLL 95 >ref|XP_001783842.1| predicted protein [Physcomitrella patens] gi|162664620|gb|EDQ51332.1| predicted protein [Physcomitrella patens] Length = 112 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 373 DDLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 ++LSKP TAYCRCW S+TFPLC+G H KHNKETGDNVGPLLL Sbjct: 69 NELSKPLTAYCRCWRSETFPLCNGAHVKHNKETGDNVGPLLL 110 >gb|EMJ19796.1| hypothetical protein PRUPE_ppa013339mg [Prunus persica] Length = 128 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/73 (50%), Positives = 49/73 (67%) Frame = -3 Query: 466 KLCVCLATQPHPLELQMQRAKE*EGAXXXXXDDLSKPTTAYCRCWLSKTFPLCDGTHAKH 287 K V + + P+ ++++++E + +LSKP T YCRCW S TFPLCDG+H KH Sbjct: 54 KPMVVVKAEAQPINPEIRKSEE-KVVDSVVVSELSKPLTVYCRCWRSGTFPLCDGSHVKH 112 Query: 286 NKETGDNVGPLLL 248 NK TGDNVGPLLL Sbjct: 113 NKATGDNVGPLLL 125 >ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Citrus sinensis] Length = 130 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 87 ELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 127 >ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] gi|557523645|gb|ESR35012.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] Length = 198 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 155 ELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 195 >ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] gi|550322696|gb|EEF05981.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] Length = 173 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 128 ELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 168 >ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] gi|222859540|gb|EEE97087.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] Length = 107 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 62 ELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 102 >ref|XP_002960535.1| hypothetical protein SELMODRAFT_437606 [Selaginella moellendorffii] gi|300171474|gb|EFJ38074.1| hypothetical protein SELMODRAFT_437606 [Selaginella moellendorffii] Length = 628 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 ++SKP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 586 EISKPVTAYCRCWRSGTFPLCDGSHMKHNKATGDNVGPLLL 626 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +L+KP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 55 ELAKPVTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 95 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +L+KP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 75 ELAKPVTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 115 >gb|ABK20944.1| unknown [Picea sitchensis] Length = 107 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP T YCRCW S+TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 65 ELSKPITPYCRCWRSQTFPLCDGSHVKHNKATGDNVGPLLL 105 >gb|AFK46198.1| unknown [Lotus japonicus] Length = 118 Score = 79.7 bits (195), Expect = 4e-13 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +L+KP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 76 ELAKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 116 >gb|ESW24382.1| hypothetical protein PHAVU_004G125800g [Phaseolus vulgaris] Length = 111 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP AYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 69 ELSKPVNAYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 109 >gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] Length = 99 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +L KP TAYCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 56 ELGKPVTAYCRCWRSGTFPLCDGSHVKHNKGTGDNVGPLLL 96 >gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [Morus notabilis] Length = 117 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP T YCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 74 ELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 114 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP T YCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 66 ELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 106 >ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Glycine max] Length = 113 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP T YCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 71 ELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 111 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 79.0 bits (193), Expect = 6e-13 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -3 Query: 370 DLSKPTTAYCRCWLSKTFPLCDGTHAKHNKETGDNVGPLLL 248 +LSKP T YCRCW S TFPLCDG+H KHNK TGDNVGPLLL Sbjct: 71 ELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLL 111