BLASTX nr result
ID: Ephedra27_contig00002784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00002784 (471 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006859188.1| hypothetical protein AMTR_s00070p00165510 [A... 59 9e-07 >ref|XP_006859188.1| hypothetical protein AMTR_s00070p00165510 [Amborella trichopoda] gi|548863301|gb|ERN20655.1| hypothetical protein AMTR_s00070p00165510 [Amborella trichopoda] Length = 135 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/62 (46%), Positives = 43/62 (69%) Frame = +3 Query: 33 KVTVRGTHPTEDQAYSAAILEMVYELETTASQVLSKVRAIAKSQTLSLKDRLKSIQGCQS 212 K +V G + TEDQAY+AAI +++++E L K +AIA S+TL LK+RL+++ QS Sbjct: 30 KDSVHGVYKTEDQAYAAAIHNLIHDMEAVEGCRLPKKKAIAVSETLMLKERLQTVLAMQS 89 Query: 213 PE 218 PE Sbjct: 90 PE 91