BLASTX nr result
ID: Ephedra27_contig00002255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00002255 (396 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB80094.1| Chlorophyll a-b binding protein 6A [Morus notabilis] 69 6e-10 emb|CBI31475.3| unnamed protein product [Vitis vinifera] 69 6e-10 ref|XP_002275552.1| PREDICTED: chlorophyll a-b binding protein 6... 69 6e-10 ref|XP_006854492.1| hypothetical protein AMTR_s00175p00040360 [A... 69 8e-10 gb|EPS58306.1| hypothetical protein M569_16509, partial [Genlise... 68 1e-09 gb|ABV82714.1| chloroplast chlorophyll a/b binding protein precu... 67 2e-09 ref|XP_002315298.1| putative chlorophyll a/b-binding family prot... 67 2e-09 gb|AFW70295.1| hypothetical protein ZEAMMB73_802965 [Zea mays] 67 2e-09 gb|ACN30800.1| unknown [Zea mays] 67 2e-09 ref|NP_001148183.1| chlorophyll a-b binding protein 6A [Zea mays... 67 2e-09 ref|XP_006436282.1| hypothetical protein CICLE_v10032568mg [Citr... 67 3e-09 gb|EMJ02438.1| hypothetical protein PRUPE_ppa010511mg [Prunus pe... 67 3e-09 ref|XP_002451621.1| hypothetical protein SORBIDRAFT_04g004770 [S... 67 3e-09 gb|ABK23400.1| unknown [Picea sitchensis] gi|148907739|gb|ABR169... 66 4e-09 ref|XP_004965344.1| PREDICTED: chlorophyll a-b binding protein 1... 66 5e-09 ref|NP_001149586.1| chlorophyll a-b binding protein 6A [Zea mays... 66 5e-09 ref|XP_006656037.1| PREDICTED: chlorophyll a-b binding protein 1... 65 7e-09 ref|XP_004307395.1| PREDICTED: chlorophyll a-b binding protein 6... 65 7e-09 ref|XP_004143800.1| PREDICTED: chlorophyll a-b binding protein 6... 65 7e-09 ref|XP_006599410.1| PREDICTED: chlorophyll a-b binding protein 6... 65 9e-09 >gb|EXB80094.1| Chlorophyll a-b binding protein 6A [Morus notabilis] Length = 245 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI D++IPRSILP Sbjct: 212 AYPGTGPLENLATHLADPWHNNIGDIIIPRSILP 245 >emb|CBI31475.3| unnamed protein product [Vitis vinifera] Length = 201 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HLADPWHNNI DV+IPRSI+P Sbjct: 168 AYPGTGPLENLASHLADPWHNNIGDVIIPRSIMP 201 >ref|XP_002275552.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic isoform 1 [Vitis vinifera] gi|147800947|emb|CAN75566.1| hypothetical protein VITISV_032585 [Vitis vinifera] Length = 244 Score = 68.9 bits (167), Expect = 6e-10 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HLADPWHNNI DV+IPRSI+P Sbjct: 211 AYPGTGPLENLASHLADPWHNNIGDVIIPRSIMP 244 >ref|XP_006854492.1| hypothetical protein AMTR_s00175p00040360 [Amborella trichopoda] gi|548858170|gb|ERN15959.1| hypothetical protein AMTR_s00175p00040360 [Amborella trichopoda] Length = 230 Score = 68.6 bits (166), Expect = 8e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 + PGTGPLENLA HLADPWHNNI DV+IPRSILP Sbjct: 197 ARPGTGPLENLATHLADPWHNNIGDVIIPRSILP 230 >gb|EPS58306.1| hypothetical protein M569_16509, partial [Genlisea aurea] Length = 180 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HL+DPWHNNI D++IPRSILP Sbjct: 147 AYPGTGPLENLATHLSDPWHNNIGDIIIPRSILP 180 >gb|ABV82714.1| chloroplast chlorophyll a/b binding protein precursor [Phyllostachys edulis] Length = 246 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HLADPWHNNI DV+IPRSI P Sbjct: 213 AYPGTGPLENLASHLADPWHNNIGDVVIPRSIYP 246 >ref|XP_002315298.1| putative chlorophyll a/b-binding family protein [Populus trichocarpa] gi|118489209|gb|ABK96411.1| unknown [Populus trichocarpa x Populus deltoides] gi|222864338|gb|EEF01469.1| putative chlorophyll a/b-binding family protein [Populus trichocarpa] Length = 243 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI DVLIPRS+ P Sbjct: 210 AYPGTGPLENLATHLADPWHNNIGDVLIPRSVSP 243 >gb|AFW70295.1| hypothetical protein ZEAMMB73_802965 [Zea mays] Length = 150 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HLADPWHNNI D++IPRSI P Sbjct: 117 AYPGTGPLENLASHLADPWHNNIGDIIIPRSISP 150 >gb|ACN30800.1| unknown [Zea mays] Length = 196 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HLADPWHNNI D++IPRSI P Sbjct: 163 AYPGTGPLENLASHLADPWHNNIGDIIIPRSISP 196 >ref|NP_001148183.1| chlorophyll a-b binding protein 6A [Zea mays] gi|195612072|gb|ACG27866.1| chlorophyll a-b binding protein 6A [Zea mays] gi|195616508|gb|ACG30084.1| chlorophyll a-b binding protein 6A [Zea mays] gi|223975041|gb|ACN31708.1| unknown [Zea mays] gi|413935743|gb|AFW70294.1| chlorophyll a-b binding protein 6A [Zea mays] Length = 245 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HLADPWHNNI D++IPRSI P Sbjct: 212 AYPGTGPLENLASHLADPWHNNIGDIIIPRSISP 245 >ref|XP_006436282.1| hypothetical protein CICLE_v10032568mg [Citrus clementina] gi|568864996|ref|XP_006485870.1| PREDICTED: chlorophyll a-b binding protein 6, chloroplastic-like [Citrus sinensis] gi|557538478|gb|ESR49522.1| hypothetical protein CICLE_v10032568mg [Citrus clementina] Length = 245 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI DV+IPR I+P Sbjct: 212 AYPGTGPLENLATHLADPWHNNIGDVIIPRGIVP 245 >gb|EMJ02438.1| hypothetical protein PRUPE_ppa010511mg [Prunus persica] Length = 247 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI DV+IP+ ILP Sbjct: 214 AYPGTGPLENLATHLADPWHNNIGDVIIPKGILP 247 >ref|XP_002451621.1| hypothetical protein SORBIDRAFT_04g004770 [Sorghum bicolor] gi|241931452|gb|EES04597.1| hypothetical protein SORBIDRAFT_04g004770 [Sorghum bicolor] Length = 245 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI D++IPRSI P Sbjct: 212 AYPGTGPLENLATHLADPWHNNIGDIIIPRSISP 245 >gb|ABK23400.1| unknown [Picea sitchensis] gi|148907739|gb|ABR16996.1| unknown [Picea sitchensis] gi|224284102|gb|ACN39788.1| unknown [Picea sitchensis] Length = 247 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILPF 291 ++PGTGPLENLA HL+DPWH NIA+++IPRSILP+ Sbjct: 213 ANPGTGPLENLATHLSDPWHKNIAEIIIPRSILPY 247 >ref|XP_004965344.1| PREDICTED: chlorophyll a-b binding protein 1B-21, chloroplastic-like [Setaria italica] Length = 300 Score = 65.9 bits (159), Expect = 5e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI D++IPR+I P Sbjct: 267 AYPGTGPLENLATHLADPWHNNIGDIIIPRTIYP 300 >ref|NP_001149586.1| chlorophyll a-b binding protein 6A [Zea mays] gi|194706946|gb|ACF87557.1| unknown [Zea mays] gi|195628244|gb|ACG35952.1| chlorophyll a-b binding protein 6A [Zea mays] gi|413926425|gb|AFW66357.1| chlorophyll a-b binding protein 6A [Zea mays] Length = 249 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI D++IPRSI P Sbjct: 216 AYPGTGPLENLAAHLADPWHNNIGDIIIPRSISP 249 >ref|XP_006656037.1| PREDICTED: chlorophyll a-b binding protein 1B-21, chloroplastic-like [Oryza brachyantha] Length = 244 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA+HL+DPWHNNI DV+IPR+I P Sbjct: 211 AYPGTGPLENLASHLSDPWHNNIGDVIIPRTIYP 244 >ref|XP_004307395.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 247 Score = 65.5 bits (158), Expect = 7e-09 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI D++IP+ +LP Sbjct: 213 AYPGTGPLENLATHLADPWHNNIGDIIIPKGLLP 246 >ref|XP_004143800.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like [Cucumis sativus] gi|449525097|ref|XP_004169556.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like [Cucumis sativus] Length = 246 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI D++IPR+I P Sbjct: 213 AYPGTGPLENLATHLADPWHNNIGDIIIPRTISP 246 >ref|XP_006599410.1| PREDICTED: chlorophyll a-b binding protein 6A, chloroplastic-like [Glycine max] Length = 290 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -2 Query: 395 SHPGTGPLENLANHLADPWHNNIADVLIPRSILP 294 ++PGTGPLENLA HLADPWHNNI +V+IP+SILP Sbjct: 257 AYPGTGPLENLAAHLADPWHNNIGNVIIPQSILP 290