BLASTX nr result
ID: Ephedra27_contig00001969
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00001969 (402 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23753.1| unknown [Picea sitchensis] gi|116794248|gb|ABK270... 115 8e-24 gb|ADQ37303.1| putative spermidine synthase [Pinus sylvestris] 113 3e-23 gb|AGU71340.1| spermidine synthase, partial [Lumnitzera racemosa] 108 7e-22 gb|AEX20346.1| spermidine synthase [Medicago sativa] 107 1e-21 sp|Q9ZTR1.1|SPD1_PEA RecName: Full=Spermidine synthase 1; Short=... 107 2e-21 ref|XP_006416052.1| hypothetical protein EUTSA_v10007822mg [Eutr... 106 3e-21 ref|NP_001267711.1| spermidine synthase-like [Cucumis sativus] g... 106 3e-21 dbj|BAJ33639.1| unnamed protein product [Thellungiella halophila] 106 3e-21 sp|Q96557.1|SPD2_DATST RecName: Full=Spermidine synthase 2; Shor... 106 4e-21 ref|XP_004489856.1| PREDICTED: spermidine synthase 1-like [Cicer... 106 4e-21 ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arab... 106 4e-21 ref|NP_001239861.1| uncharacterized protein LOC100792107 [Glycin... 106 4e-21 ref|NP_177188.1| Spermidine synthase 2 [Arabidopsis thaliana] gi... 105 5e-21 gb|AGW82430.1| spermidine synthase [Camellia sinensis] 105 5e-21 ref|XP_003613246.1| Spermidine synthase [Medicago truncatula] gi... 105 5e-21 sp|Q9ZUB3.1|SPD1_ARATH RecName: Full=Spermidine synthase 1; Shor... 105 6e-21 ref|XP_006305089.1| hypothetical protein CARUB_v10009456mg [Caps... 105 6e-21 ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, part... 105 6e-21 ref|XP_002890597.1| hypothetical protein ARALYDRAFT_889925 [Arab... 105 6e-21 ref|NP_973900.2| spermidine synthase 1 [Arabidopsis thaliana] gi... 105 6e-21 >gb|ABK23753.1| unknown [Picea sitchensis] gi|116794248|gb|ABK27063.1| unknown [Picea sitchensis] Length = 338 Score = 115 bits (287), Expect = 8e-24 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 YPSVIPGWFAE+SPMWPGEAHSLKVE+VL+QGKSKYQD+MVFQS TYGKVLVLDGVI Sbjct: 38 YPSVIPGWFAEISPMWPGEAHSLKVEKVLFQGKSKYQDVMVFQSLTYGKVLVLDGVI 94 >gb|ADQ37303.1| putative spermidine synthase [Pinus sylvestris] Length = 345 Score = 113 bits (282), Expect = 3e-23 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 YPSVIPGWFAE+SPMWPGEAHSLKVE+VL+QGKSKYQ++MVFQS TYGKVLVLDGVI Sbjct: 45 YPSVIPGWFAEISPMWPGEAHSLKVEKVLFQGKSKYQNVMVFQSLTYGKVLVLDGVI 101 >gb|AGU71340.1| spermidine synthase, partial [Lumnitzera racemosa] Length = 88 Score = 108 bits (270), Expect = 7e-22 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = +2 Query: 227 SYPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 S SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD+MVFQSATYGKVLVLDGVI Sbjct: 4 SISSVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSATYGKVLVLDGVI 61 >gb|AEX20346.1| spermidine synthase [Medicago sativa] Length = 344 Score = 107 bits (268), Expect = 1e-21 Identities = 48/55 (87%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD+MVFQSATYGKVLVLDGVI Sbjct: 51 SVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSATYGKVLVLDGVI 105 >sp|Q9ZTR1.1|SPD1_PEA RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: Full=Putrescine aminopropyltransferase 1 gi|4104972|gb|AAD02231.1| spermidine synthase 1 [Pisum sativum] Length = 334 Score = 107 bits (267), Expect = 2e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD+MVFQSATYGKVL+LDGVI Sbjct: 41 SVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSATYGKVLILDGVI 95 >ref|XP_006416052.1| hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum] gi|557093823|gb|ESQ34405.1| hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum] Length = 397 Score = 106 bits (265), Expect = 3e-21 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 + SVIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 103 FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVI 159 >ref|NP_001267711.1| spermidine synthase-like [Cucumis sativus] gi|49425361|gb|AAT66041.1| spermidine synthase [Cucumis sativus] Length = 317 Score = 106 bits (265), Expect = 3e-21 Identities = 48/58 (82%), Positives = 55/58 (94%) Frame = +2 Query: 227 SYPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 S SVIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQS+TYGKVLVLDGVI Sbjct: 23 SISSVIPGWFSEISPMWPGEAHSLKVEKVLFQGKSDYQDVLVFQSSTYGKVLVLDGVI 80 >dbj|BAJ33639.1| unnamed protein product [Thellungiella halophila] Length = 176 Score = 106 bits (265), Expect = 3e-21 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 + SVIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 46 FSSVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVI 102 >sp|Q96557.1|SPD2_DATST RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi|1561579|emb|CAA69421.1| spermidine synthase 2 [Datura stramonium] Length = 317 Score = 106 bits (264), Expect = 4e-21 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = +2 Query: 221 TPSYPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 +P SV+PGWF+E+SP+WPGEAHSLKVE++L+QGKS YQD+MVFQS TYGKVLVLDGVI Sbjct: 19 SPCISSVLPGWFSEISPLWPGEAHSLKVEKILFQGKSDYQDVMVFQSTTYGKVLVLDGVI 78 >ref|XP_004489856.1| PREDICTED: spermidine synthase 1-like [Cicer arietinum] Length = 340 Score = 106 bits (264), Expect = 4e-21 Identities = 46/55 (83%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD+MVFQS+TYGKVL+LDGVI Sbjct: 47 SVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVMVFQSSTYGKVLILDGVI 101 >ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] gi|297334608|gb|EFH65026.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] Length = 340 Score = 106 bits (264), Expect = 4e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 46 SVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVI 100 >ref|NP_001239861.1| uncharacterized protein LOC100792107 [Glycine max] gi|255641867|gb|ACU21202.1| unknown [Glycine max] Length = 340 Score = 106 bits (264), Expect = 4e-21 Identities = 48/62 (77%), Positives = 57/62 (91%), Gaps = 3/62 (4%) Frame = +2 Query: 224 PSYP---SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDG 394 P YP +VIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQ++MVFQS+TYGKVLVLDG Sbjct: 41 PQYPGISAVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSSTYGKVLVLDG 100 Query: 395 VI 400 VI Sbjct: 101 VI 102 >ref|NP_177188.1| Spermidine synthase 2 [Arabidopsis thaliana] gi|12644069|sp|O48661.2|SPD2_ARATH RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi|14030637|gb|AAK52993.1|AF375409_1 At1g70310/F17O7_16 [Arabidopsis thaliana] gi|3176685|gb|AAC18808.1| Strong similarity to spermidine synthase 1, gb|Y08252 and possibly closer similarity to spermidine synthase 2 gb|Y08253 from Datura stramonium. ESTs gb|N38155, gb|T41738, gb|AA597626, gb|AA712967 and gb|AA712346 come from this gene [Arabidopsis thaliana] gi|6468491|emb|CAB61615.1| spermidine synthase 2 [Arabidopsis thaliana] gi|56381993|gb|AAV85715.1| At1g70310 [Arabidopsis thaliana] gi|332196923|gb|AEE35044.1| Spermidine synthase 2 [Arabidopsis thaliana] Length = 340 Score = 105 bits (263), Expect = 5e-21 Identities = 46/55 (83%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 S+IPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 46 SIIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVI 100 >gb|AGW82430.1| spermidine synthase [Camellia sinensis] Length = 329 Score = 105 bits (263), Expect = 5e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQ++MVFQSATYGKVLVLDGVI Sbjct: 35 SVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVI 89 >ref|XP_003613246.1| Spermidine synthase [Medicago truncatula] gi|355514581|gb|AES96204.1| Spermidine synthase [Medicago truncatula] Length = 343 Score = 105 bits (263), Expect = 5e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQ++MVFQSATYGKVLVLDGVI Sbjct: 50 SVIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQNVMVFQSATYGKVLVLDGVI 104 >sp|Q9ZUB3.1|SPD1_ARATH RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: Full=Putrescine aminopropyltransferase 1 gi|4056467|gb|AAC98040.1| Strong similarity to gb|AB006693 spermidine synthase from Arabidopsis thaliana. ESTs gb|AA389822, gb|T41794, gb|N38455, gb|AI100106, gb|F14442 and gb|F14256 come from this gene [Arabidopsis thaliana] gi|6468489|emb|CAB61614.1| spermidine synthase 1 [Arabidopsis thaliana] gi|6682289|emb|CAB64644.1| spermidine synthase [Arabidopsis thaliana] gi|17065034|gb|AAL32671.1| Strong similarity to spermidine synthase [Arabidopsis thaliana] gi|20260024|gb|AAM13359.1| strong similarity to spermidine synthase [Arabidopsis thaliana] Length = 334 Score = 105 bits (262), Expect = 6e-21 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 + +VIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 40 FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVI 96 >ref|XP_006305089.1| hypothetical protein CARUB_v10009456mg [Capsella rubella] gi|482573800|gb|EOA37987.1| hypothetical protein CARUB_v10009456mg [Capsella rubella] Length = 378 Score = 105 bits (262), Expect = 6e-21 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 + +VIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 84 FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVI 140 >ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella] gi|482571130|gb|EOA35318.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella] Length = 368 Score = 105 bits (262), Expect = 6e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = +2 Query: 236 SVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 SVIPGWF+E+SPMWPGEAHSLKVE++L+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 73 SVIPGWFSEMSPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVI 127 >ref|XP_002890597.1| hypothetical protein ARALYDRAFT_889925 [Arabidopsis lyrata subsp. lyrata] gi|297336439|gb|EFH66856.1| hypothetical protein ARALYDRAFT_889925 [Arabidopsis lyrata subsp. lyrata] Length = 378 Score = 105 bits (262), Expect = 6e-21 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 + +VIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 84 FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVI 140 >ref|NP_973900.2| spermidine synthase 1 [Arabidopsis thaliana] gi|332192314|gb|AEE30435.1| spermidine synthase 1 [Arabidopsis thaliana] Length = 327 Score = 105 bits (262), Expect = 6e-21 Identities = 47/57 (82%), Positives = 55/57 (96%) Frame = +2 Query: 230 YPSVIPGWFAEVSPMWPGEAHSLKVEEVLYQGKSKYQDIMVFQSATYGKVLVLDGVI 400 + +VIPGWF+E+SPMWPGEAHSLKVE+VL+QGKS YQD++VFQSATYGKVLVLDGVI Sbjct: 84 FSTVIPGWFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVI 140