BLASTX nr result
ID: Ephedra27_contig00001948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00001948 (1029 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003558500.1| PREDICTED: protein RIK-like [Brachypodium di... 62 4e-07 >ref|XP_003558500.1| PREDICTED: protein RIK-like [Brachypodium distachyon] Length = 661 Score = 62.0 bits (149), Expect = 4e-07 Identities = 50/148 (33%), Positives = 71/148 (47%), Gaps = 15/148 (10%) Frame = -3 Query: 793 LREMPSRDISSSDVSLMPPPPPKVI---SSRSMPPTDDRSMSSLPPPKNSSSR------K 641 L+ MPS S+ +S PPPPPK + SS++MPP +SM PPPK S+ + Sbjct: 515 LQHMPSHLSVSTGMS-PPPPPPKNMSPPSSKNMPPPPPKSMPP-PPPKFPSNEVLRNESR 572 Query: 640 FTPVSEMLTTPLPLD-STVSSTASLSTDGTQIFXXXXXXXXXXXXXXSLKLVDYGEEDDE 464 + V E + P LD S+VS S S LKL+DYG++DD+ Sbjct: 573 HSAVKEPMAPPRSLDVSSVSPPKSWSAQLPSKDPREEKPSSASVSETLLKLMDYGDDDDD 632 Query: 463 DSNVPV-----IPKHDETLYPNGKPFWA 395 D + + +P + T P KPFW+ Sbjct: 633 DDDDDIDETDSVPGGNTTPSPGQKPFWS 660