BLASTX nr result
ID: Ephedra27_contig00001823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00001823 (548 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK24574.1| unknown [Picea sitchensis] gi|224284157|gb|ACN398... 86 4e-15 gb|AFG52792.1| hypothetical protein 0_11459_02, partial [Pinus t... 84 2e-14 gb|AEW07780.1| hypothetical protein 0_11459_02, partial [Pinus r... 84 2e-14 gb|AFG52796.1| hypothetical protein 0_11459_02, partial [Pinus t... 84 3e-14 gb|AFK35396.1| unknown [Medicago truncatula] 80 2e-13 gb|ACJ85634.1| unknown [Medicago truncatula] 80 2e-13 ref|XP_003591514.1| DNA photolyase protein [Medicago truncatula]... 80 2e-13 gb|EOX95102.1| Photolyase/blue-light receptor 2 isoform 2 [Theob... 79 7e-13 gb|EOX95101.1| Photolyase/blue-light receptor 2 isoform 1 [Theob... 79 7e-13 ref|XP_003518993.1| PREDICTED: blue-light photoreceptor PHR2-lik... 79 9e-13 ref|XP_001760563.1| predicted protein [Physcomitrella patens] gi... 78 1e-12 ref|XP_006479977.1| PREDICTED: blue-light photoreceptor PHR2-lik... 78 2e-12 gb|ESW16325.1| hypothetical protein PHAVU_007G147100g [Phaseolus... 78 2e-12 ref|XP_006444371.1| hypothetical protein CICLE_v10020039mg [Citr... 78 2e-12 ref|XP_006444370.1| hypothetical protein CICLE_v10020039mg [Citr... 78 2e-12 ref|XP_006444369.1| hypothetical protein CICLE_v10020039mg [Citr... 78 2e-12 gb|EMJ01030.1| hypothetical protein PRUPE_ppa005477mg [Prunus pe... 77 2e-12 ref|XP_003536113.1| PREDICTED: blue-light photoreceptor PHR2-lik... 77 2e-12 ref|XP_002523092.1| DNA photolyase, putative [Ricinus communis] ... 77 2e-12 gb|AFX88303.1| photolyase/blue-light receptor 2, partial [Arabid... 77 3e-12 >gb|ABK24574.1| unknown [Picea sitchensis] gi|224284157|gb|ACN39815.1| unknown [Picea sitchensis] Length = 526 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+NAAALRKAAIVWFRNDLR+HDNEA S+ANKE+LSVLPVYCFD Sbjct: 179 DPSNAAALRKAAIVWFRNDLRVHDNEALSSANKEALSVLPVYCFD 223 >gb|AFG52792.1| hypothetical protein 0_11459_02, partial [Pinus taeda] Length = 119 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+NAAA+RKAAIVWFRNDLR+HDNEA + ANKE+LSVLPVYCFD Sbjct: 47 DPSNAAAMRKAAIVWFRNDLRVHDNEALTNANKEALSVLPVYCFD 91 >gb|AEW07780.1| hypothetical protein 0_11459_02, partial [Pinus radiata] gi|383142788|gb|AFG52782.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142789|gb|AFG52783.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142790|gb|AFG52784.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142791|gb|AFG52785.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142792|gb|AFG52786.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142793|gb|AFG52787.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142794|gb|AFG52788.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142795|gb|AFG52789.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142796|gb|AFG52790.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142797|gb|AFG52791.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142799|gb|AFG52793.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142800|gb|AFG52794.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142801|gb|AFG52795.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142803|gb|AFG52797.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142804|gb|AFG52798.1| hypothetical protein 0_11459_02, partial [Pinus taeda] gi|383142805|gb|AFG52799.1| hypothetical protein 0_11459_02, partial [Pinus taeda] Length = 119 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+NAAA+RKAAIVWFRNDLR+HDNEA + ANKE+LSVLPVYCFD Sbjct: 47 DPSNAAAMRKAAIVWFRNDLRVHDNEALTNANKEALSVLPVYCFD 91 >gb|AFG52796.1| hypothetical protein 0_11459_02, partial [Pinus taeda] Length = 119 Score = 83.6 bits (205), Expect = 3e-14 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+NAAA+RKAAIVWFRNDLR+HDNEA + ANKE+LS+LPVYCFD Sbjct: 47 DPSNAAAMRKAAIVWFRNDLRVHDNEALTNANKEALSILPVYCFD 91 >gb|AFK35396.1| unknown [Medicago truncatula] Length = 456 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P++AAALR+ AIVWFRNDLR+HDNEA +TAN ES+SVLPVYCFD Sbjct: 109 DPSSAAALRRTAIVWFRNDLRVHDNEALNTANNESISVLPVYCFD 153 >gb|ACJ85634.1| unknown [Medicago truncatula] Length = 235 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P++AAALR+ AIVWFRNDLR+HDNEA +TAN ES+SVLPVYCFD Sbjct: 109 DPSSAAALRRTAIVWFRNDLRVHDNEALNTANNESISVLPVYCFD 153 >ref|XP_003591514.1| DNA photolyase protein [Medicago truncatula] gi|355480562|gb|AES61765.1| DNA photolyase protein [Medicago truncatula] Length = 456 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P++AAALR+ AIVWFRNDLR+HDNEA +TAN ES+SVLPVYCFD Sbjct: 109 DPSSAAALRRTAIVWFRNDLRVHDNEALNTANNESISVLPVYCFD 153 >gb|EOX95102.1| Photolyase/blue-light receptor 2 isoform 2 [Theobroma cacao] Length = 489 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+N AA+R+A+IVWFRNDLR+HDNE +TAN ES+SVLPVYCFD Sbjct: 119 DPSNGAAIRRASIVWFRNDLRVHDNECLNTANNESMSVLPVYCFD 163 >gb|EOX95101.1| Photolyase/blue-light receptor 2 isoform 1 [Theobroma cacao] Length = 466 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+N AA+R+A+IVWFRNDLR+HDNE +TAN ES+SVLPVYCFD Sbjct: 119 DPSNGAAIRRASIVWFRNDLRVHDNECLNTANNESMSVLPVYCFD 163 >ref|XP_003518993.1| PREDICTED: blue-light photoreceptor PHR2-like [Glycine max] Length = 428 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -2 Query: 160 RPRPXXXEPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 RPR +P+NAAALR+AA+VWFRNDLRL DNE + AN ESLSVLPVYCFD Sbjct: 77 RPR----DPSNAAALRRAAVVWFRNDLRLLDNECLTAANNESLSVLPVYCFD 124 >ref|XP_001760563.1| predicted protein [Physcomitrella patens] gi|162688260|gb|EDQ74638.1| predicted protein [Physcomitrella patens] Length = 528 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -2 Query: 151 PXXXEPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 P +PAN LR+A+IVWFRNDLR+HDNEA +AN++SLS+LPVYCFD Sbjct: 165 PDFKDPANGCGLRRASIVWFRNDLRVHDNEALVSANRDSLSILPVYCFD 213 >ref|XP_006479977.1| PREDICTED: blue-light photoreceptor PHR2-like [Citrus sinensis] Length = 462 Score = 77.8 bits (190), Expect = 2e-12 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P N AA+R+A+IVWFRNDLR+HDNE+ +TAN ES+SVLPVYCFD Sbjct: 115 DPNNGAAIRRASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFD 159 >gb|ESW16325.1| hypothetical protein PHAVU_007G147100g [Phaseolus vulgaris] Length = 450 Score = 77.8 bits (190), Expect = 2e-12 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 160 RPRPXXXEPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 RPR +P+NAAALR+AA+VWFRNDLR+ DNE ++AN ESLSVLPVYCFD Sbjct: 100 RPR----DPSNAAALRRAAVVWFRNDLRVLDNECLASANSESLSVLPVYCFD 147 >ref|XP_006444371.1| hypothetical protein CICLE_v10020039mg [Citrus clementina] gi|557546633|gb|ESR57611.1| hypothetical protein CICLE_v10020039mg [Citrus clementina] Length = 462 Score = 77.8 bits (190), Expect = 2e-12 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P N AA+R+A+IVWFRNDLR+HDNE+ +TAN ES+SVLPVYCFD Sbjct: 115 DPNNGAAIRRASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFD 159 >ref|XP_006444370.1| hypothetical protein CICLE_v10020039mg [Citrus clementina] gi|557546632|gb|ESR57610.1| hypothetical protein CICLE_v10020039mg [Citrus clementina] Length = 465 Score = 77.8 bits (190), Expect = 2e-12 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P N AA+R+A+IVWFRNDLR+HDNE+ +TAN ES+SVLPVYCFD Sbjct: 115 DPNNGAAIRRASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFD 159 >ref|XP_006444369.1| hypothetical protein CICLE_v10020039mg [Citrus clementina] gi|557546631|gb|ESR57609.1| hypothetical protein CICLE_v10020039mg [Citrus clementina] Length = 436 Score = 77.8 bits (190), Expect = 2e-12 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P N AA+R+A+IVWFRNDLR+HDNE+ +TAN ES+SVLPVYCFD Sbjct: 115 DPNNGAAIRRASIVWFRNDLRVHDNESLNTANNESVSVLPVYCFD 159 >gb|EMJ01030.1| hypothetical protein PRUPE_ppa005477mg [Prunus persica] Length = 459 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+N AA+R+A+IVWFRNDLR+HDNE ++AN ES+SVLPVYCFD Sbjct: 115 DPSNGAAIRRASIVWFRNDLRVHDNECLNSANNESMSVLPVYCFD 159 >ref|XP_003536113.1| PREDICTED: blue-light photoreceptor PHR2-like [Glycine max] Length = 440 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 160 RPRPXXXEPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 RPR +P+NAAALR+AA+VWFRNDLRL DNE + AN +SLSVLPVYCFD Sbjct: 89 RPR----DPSNAAALRRAAVVWFRNDLRLLDNECLTAANNDSLSVLPVYCFD 136 >ref|XP_002523092.1| DNA photolyase, putative [Ricinus communis] gi|223537654|gb|EEF39277.1| DNA photolyase, putative [Ricinus communis] Length = 458 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P+NAA +R+A+IVWFRNDLR+HDNE ++AN ES+SVLPVYCFD Sbjct: 117 DPSNAAGIRRASIVWFRNDLRVHDNECLNSANNESMSVLPVYCFD 161 >gb|AFX88303.1| photolyase/blue-light receptor 2, partial [Arabidopsis thaliana] gi|424711472|gb|AFX88306.1| photolyase/blue-light receptor 2, partial [Arabidopsis thaliana] gi|424711480|gb|AFX88310.1| photolyase/blue-light receptor 2, partial [Arabidopsis thaliana] gi|424711492|gb|AFX88316.1| photolyase/blue-light receptor 2, partial [Arabidopsis thaliana] Length = 188 Score = 77.0 bits (188), Expect = 3e-12 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -2 Query: 139 EPANAAALRKAAIVWFRNDLRLHDNEAFSTANKESLSVLPVYCFD 5 +P++AAALR+AA+VWFRNDLRLHDNE ++AN E +SVLPVYCFD Sbjct: 4 DPSSAAALRRAAVVWFRNDLRLHDNECLNSANDECVSVLPVYCFD 48