BLASTX nr result
ID: Ephedra27_contig00001769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00001769 (444 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001761633.1| predicted protein [Physcomitrella patens] gi... 97 2e-18 ref|XP_002965872.1| hypothetical protein SELMODRAFT_143363 [Sela... 97 3e-18 ref|XP_002983120.1| hypothetical protein SELMODRAFT_155550 [Sela... 97 3e-18 gb|ABR16369.1| unknown [Picea sitchensis] gi|148909995|gb|ABR180... 97 3e-18 ref|XP_001772529.1| predicted protein [Physcomitrella patens] gi... 96 6e-18 ref|XP_002506028.1| predicted protein [Micromonas sp. RCC299] gi... 87 2e-15 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 87 3e-15 ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Popu... 86 4e-15 ref|XP_006858075.1| hypothetical protein AMTR_s00062p00067400 [A... 86 4e-15 gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum cr... 86 4e-15 ref|XP_002323872.1| cystathionine gamma synthase family protein ... 86 4e-15 gb|ABK96139.1| unknown [Populus trichocarpa] 86 4e-15 gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus pe... 86 7e-15 gb|AGF95116.1| cystathionine gamma synthase, partial [Prunus per... 86 7e-15 emb|CCO18050.1| cystathionine gamma-synthase [Bathycoccus prasinos] 86 7e-15 ref|XP_002529997.1| cystathionine gamma-synthase, putative [Rici... 85 1e-14 emb|CBI22246.3| unnamed protein product [Vitis vinifera] 84 1e-14 ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chl... 84 1e-14 ref|XP_004172088.1| PREDICTED: cystathionine gamma-synthase, chl... 84 3e-14 ref|XP_004136690.1| PREDICTED: cystathionine gamma-synthase, chl... 84 3e-14 >ref|XP_001761633.1| predicted protein [Physcomitrella patens] gi|162687317|gb|EDQ73701.1| predicted protein [Physcomitrella patens] Length = 526 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/55 (78%), Positives = 51/55 (92%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 G ESLVEQPTIISYWDQSP+ERAR+GIKDNLVRFSCGVEDY+D+ +D++ +LD L Sbjct: 472 GVESLVEQPTIISYWDQSPAERARIGIKDNLVRFSCGVEDYEDILNDVMQSLDAL 526 >ref|XP_002965872.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii] gi|300166686|gb|EFJ33292.1| hypothetical protein SELMODRAFT_143363 [Selaginella moellendorffii] Length = 466 Score = 96.7 bits (239), Expect = 3e-18 Identities = 41/55 (74%), Positives = 52/55 (94%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCESLVEQPTIISYWDQSP+ERA++GIKDNLVRFSCG+EDY+D+ +D++ +L +L Sbjct: 412 GCESLVEQPTIISYWDQSPAERAKMGIKDNLVRFSCGIEDYEDIYADVMQSLASL 466 >ref|XP_002983120.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii] gi|300149273|gb|EFJ15929.1| hypothetical protein SELMODRAFT_155550 [Selaginella moellendorffii] Length = 467 Score = 96.7 bits (239), Expect = 3e-18 Identities = 41/55 (74%), Positives = 52/55 (94%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCESLVEQPTIISYWDQSP+ERA++GIKDNLVRFSCG+EDY+D+ +D++ +L +L Sbjct: 413 GCESLVEQPTIISYWDQSPAERAKMGIKDNLVRFSCGIEDYEDIYADVMQSLASL 467 >gb|ABR16369.1| unknown [Picea sitchensis] gi|148909995|gb|ABR18082.1| unknown [Picea sitchensis] Length = 521 Score = 96.7 bits (239), Expect = 3e-18 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCESLVEQPTIISYWDQS ERARLGIKDNLVRFSCGVE +DD++SD+L AL+ + Sbjct: 467 GCESLVEQPTIISYWDQSSEERARLGIKDNLVRFSCGVEAFDDIESDVLQALEAV 521 >ref|XP_001772529.1| predicted protein [Physcomitrella patens] gi|162676084|gb|EDQ62571.1| predicted protein [Physcomitrella patens] Length = 532 Score = 95.5 bits (236), Expect = 6e-18 Identities = 42/55 (76%), Positives = 51/55 (92%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 G ESLVEQPTIISYWDQSP+ERARLGIKDNLVRFSCG+EDY+D+ +D++ +L+ L Sbjct: 478 GVESLVEQPTIISYWDQSPAERARLGIKDNLVRFSCGIEDYEDILNDVMQSLNAL 532 >ref|XP_002506028.1| predicted protein [Micromonas sp. RCC299] gi|226521299|gb|ACO67286.1| predicted protein [Micromonas sp. RCC299] Length = 376 Score = 87.0 bits (214), Expect = 2e-15 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 G ESL+EQPT++SYWDQ P RA +GIKDNLVR +CG+EDY D+++DI+ ALD++ Sbjct: 309 GVESLIEQPTVVSYWDQGPERRAEIGIKDNLVRMACGIEDYADIEADIIQALDSI 363 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD S S+RA+ GI DNLVRFS GVED+DDLK+DIL ALD++ Sbjct: 391 GCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI 445 >ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa] gi|550320107|gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa] Length = 548 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD S SER + GIKDNLVRFS GVED++DLK+DIL AL+T+ Sbjct: 491 GCESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI 545 >ref|XP_006858075.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda] gi|548862178|gb|ERN19542.1| hypothetical protein AMTR_s00062p00067400 [Amborella trichopoda] Length = 520 Score = 86.3 bits (212), Expect = 4e-15 Identities = 36/55 (65%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+++QP I+SYWD SP ERA+ GIKDNLVRFS G+ED++DL+ D+L ALD++ Sbjct: 466 GCESIIDQPAIMSYWDLSPVERAQYGIKDNLVRFSLGIEDFEDLRMDVLQALDSI 520 >gb|AAC19395.1| cystathionine gamma-synthase [Mesembryanthemum crystallinum] Length = 548 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/55 (67%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD SPS+R + GIKDNLVRFS GVED++DLK+D+L AL+ + Sbjct: 494 GCESIVDQPAIMSYWDLSPSDRLKYGIKDNLVRFSFGVEDFEDLKADVLQALEAI 548 >ref|XP_002323872.1| cystathionine gamma synthase family protein [Populus trichocarpa] gi|222866874|gb|EEF04005.1| cystathionine gamma synthase family protein [Populus trichocarpa] Length = 532 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD S SER + GIKDNLVRFS GVED++DLK+DIL AL+T+ Sbjct: 475 GCESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI 529 >gb|ABK96139.1| unknown [Populus trichocarpa] Length = 310 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD S SER + GIKDNLVRFS GVED++DLK+DIL AL+T+ Sbjct: 253 GCESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI 307 >gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica] Length = 522 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD S SER GIKDNLVRFS GVED++DLK+DIL AL+T+ Sbjct: 468 GCESIVDQPAIMSYWDLSQSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI 522 >gb|AGF95116.1| cystathionine gamma synthase, partial [Prunus persica] Length = 157 Score = 85.5 bits (210), Expect = 7e-15 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD S SER GIKDNLVRFS GVED++DLK+DIL AL+T+ Sbjct: 103 GCESIVDQPAIMSYWDLSQSERITYGIKDNLVRFSFGVEDFEDLKADILQALETI 157 >emb|CCO18050.1| cystathionine gamma-synthase [Bathycoccus prasinos] Length = 453 Score = 85.5 bits (210), Expect = 7e-15 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 G ESL+EQPT++SYWDQ P +RA +GIKDNLVRF+CG+EDY D+++D ALD + Sbjct: 399 GVESLIEQPTVVSYWDQGPEKRAAIGIKDNLVRFACGIEDYADIEADFKQALDKI 453 >ref|XP_002529997.1| cystathionine gamma-synthase, putative [Ricinus communis] gi|223530476|gb|EEF32359.1| cystathionine gamma-synthase, putative [Ricinus communis] Length = 425 Score = 84.7 bits (208), Expect = 1e-14 Identities = 37/55 (67%), Positives = 48/55 (87%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD + SER + GIKDNLVRFS GVED++D+K+DIL AL+T+ Sbjct: 371 GCESIVDQPAIMSYWDLTQSEREKYGIKDNLVRFSFGVEDFEDMKADILQALETI 425 >emb|CBI22246.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 84.3 bits (207), Expect = 1e-14 Identities = 37/55 (67%), Positives = 49/55 (89%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD + SERA+ GI+DNLVRFS GVED++DLK+DIL AL+++ Sbjct: 443 GCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI 497 >ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Vitis vinifera] Length = 531 Score = 84.3 bits (207), Expect = 1e-14 Identities = 37/55 (67%), Positives = 49/55 (89%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+V+QP I+SYWD + SERA+ GI+DNLVRFS GVED++DLK+DIL AL+++ Sbjct: 477 GCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI 531 >ref|XP_004172088.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis sativus] Length = 139 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+++QP I+SYWD + +ER + GIKDNLVRFS G+ED++DLK+DIL ALD + Sbjct: 85 GCESIIDQPAIMSYWDLNQTERLKYGIKDNLVRFSIGIEDFEDLKADILQALDAI 139 >ref|XP_004136690.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Cucumis sativus] Length = 543 Score = 83.6 bits (205), Expect = 3e-14 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = +1 Query: 1 GCESLVEQPTIISYWDQSPSERARLGIKDNLVRFSCGVEDYDDLKSDILNALDTL 165 GCES+++QP I+SYWD + +ER + GIKDNLVRFS G+ED++DLK+DIL ALD + Sbjct: 489 GCESIIDQPAIMSYWDLNQTERLKYGIKDNLVRFSIGIEDFEDLKADILQALDAI 543