BLASTX nr result
ID: Ephedra27_contig00001446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00001446 (486 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK21762.1| unknown [Picea sitchensis] 65 7e-09 gb|ABK21481.1| unknown [Picea sitchensis] 65 7e-09 gb|EMT25753.1| Cytochrome P450 94A1 [Aegilops tauschii] 58 1e-06 gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus pe... 57 3e-06 ref|NP_001238013.1| uncharacterized protein LOC100500433 [Glycin... 56 4e-06 gb|ESW20052.1| hypothetical protein PHAVU_006G176900g [Phaseolus... 56 6e-06 sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, ... 55 7e-06 >gb|ABK21762.1| unknown [Picea sitchensis] Length = 143 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -3 Query: 484 ALGCTXXXXXXXXXXRTHGFRVRMQTPGGRKVLKRRRTKGRKILVTQTNP 335 ALGCT RTHGFR+RM+TPGGR+V+ RRR KGRK LV QTNP Sbjct: 88 ALGCTKRSRSRKSRARTHGFRLRMRTPGGRRVVNRRRAKGRKRLVPQTNP 137 >gb|ABK21481.1| unknown [Picea sitchensis] Length = 143 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -3 Query: 484 ALGCTXXXXXXXXXXRTHGFRVRMQTPGGRKVLKRRRTKGRKILVTQTNP 335 ALGCT RTHGFR+RM+TPGGR+V+ RRR KGRK LV QTNP Sbjct: 88 ALGCTKRSRSRKSRARTHGFRLRMRTPGGRRVVNRRRAKGRKRLVPQTNP 137 >gb|EMT25753.1| Cytochrome P450 94A1 [Aegilops tauschii] Length = 754 Score = 57.8 bits (138), Expect = 1e-06 Identities = 35/98 (35%), Positives = 49/98 (50%) Frame = +3 Query: 192 VEL*KLLRCVIQQIEQAVNTKQKICSLKAHADISLKDEMDYQALFPLLGFVCVTRIFLPF 371 +++ + CV+++ + L + ++ + Q P+ F V R FLP Sbjct: 463 IQMKSIAACVLERFSFQFVGGESRPGLVFSVTLRMEGGLPMQYFVPVGEFDFVHRTFLPL 522 Query: 372 VRLRLSTFLPPGVCIRTRNPCVLALDFRDLDLLVQPRA 485 RLR TFLP V IR R PC A DF DLDLLV+ RA Sbjct: 523 SRLRFRTFLPAVVRIRLRKPCTRASDFLDLDLLVRQRA 560 >gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 436 THGFRVRMQTPGGRKVLKRRRTKGRKILVTQTNP 335 THGFR RM+T GGR +LKRRR KGRKIL T+TNP Sbjct: 170 THGFRRRMRTTGGRAMLKRRRAKGRKILCTKTNP 203 >ref|NP_001238013.1| uncharacterized protein LOC100500433 [Glycine max] gi|255630327|gb|ACU15520.1| unknown [Glycine max] Length = 146 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 436 THGFRVRMQTPGGRKVLKRRRTKGRKILVTQTNP 335 THGFR RM TPGGR VL+RRR KGR++L T+T+P Sbjct: 109 THGFRKRMSTPGGRAVLRRRRAKGRRVLCTKTHP 142 >gb|ESW20052.1| hypothetical protein PHAVU_006G176900g [Phaseolus vulgaris] Length = 147 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 436 THGFRVRMQTPGGRKVLKRRRTKGRKILVTQTNP 335 THGFR RM TPGGR +L+RRR KGRKIL T+++P Sbjct: 110 THGFRKRMSTPGGRAILRRRRAKGRKILCTKSHP 143 >sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|189096152|pdb|3BBO|4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7578860|gb|AAF64157.1|AF238221_1 plastid ribosomal protein L34 precursor [Spinacia oleracea] Length = 152 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -3 Query: 436 THGFRVRMQTPGGRKVLKRRRTKGRKILVTQTNP 335 THGFR+RM T GR +LKRRR KGRKIL T+TNP Sbjct: 111 THGFRLRMSTTSGRALLKRRRAKGRKILCTKTNP 144