BLASTX nr result
ID: Ephedra27_contig00000968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra27_contig00000968 (692 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843053.1| hypothetical protein AMTR_s00186p00022000 [A... 73 7e-11 >ref|XP_006843053.1| hypothetical protein AMTR_s00186p00022000 [Amborella trichopoda] gi|548845252|gb|ERN04728.1| hypothetical protein AMTR_s00186p00022000 [Amborella trichopoda] Length = 123 Score = 73.2 bits (178), Expect = 7e-11 Identities = 30/78 (38%), Positives = 47/78 (60%) Frame = +2 Query: 410 IRGAILQGNAVQKFRSHLDCFSESGKWVYNSTARHIPWNYAGDQYASQCDGKHSSVKGNA 589 I+G + G+++ KFR HL C SESG+WVY+ R IPWN+ +QY+ +C+ +H ++G Sbjct: 44 IQGTPVLGHSIDKFRDHLRCISESGRWVYDPMPRQIPWNHVAEQYSERCEERHPGLRGEG 103 Query: 590 VGDWAEILASHPEYGNWT 643 I ++ NWT Sbjct: 104 ------IAGTYYSTANWT 115