BLASTX nr result
ID: Ephedra26_contig00026798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00026798 (524 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851422.1| hypothetical protein AMTR_s00040p00084430 [A... 59 5e-07 >ref|XP_006851422.1| hypothetical protein AMTR_s00040p00084430 [Amborella trichopoda] gi|548855116|gb|ERN13003.1| hypothetical protein AMTR_s00040p00084430 [Amborella trichopoda] Length = 671 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = +1 Query: 331 MRAARDIESGTELYDPIYPIAAALNNDMLQYRCSACFNHLPPK-IHQFPCPNSCKGSVSY 507 +RA +D+ + I P+AA+L++ +L RCS+CF+ L +FPC N+C+GSV Y Sbjct: 3 LRALQDLSRAQNVISQISPVAASLSDPLLHTRCSSCFSPLSENPSSRFPCTNTCRGSVLY 62 Query: 508 CTQQC 522 C+ C Sbjct: 63 CSLHC 67