BLASTX nr result
ID: Ephedra26_contig00026473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00026473 (483 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY16398.1| Tetratricopeptide repeat (TPR)-like superfamily p... 61 1e-07 ref|XP_002307458.2| pentatricopeptide repeat-containing family p... 60 3e-07 ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|ESW09460.1| hypothetical protein PHAVU_009G129200g [Phaseolus... 57 3e-06 ref|XP_006340242.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_004251179.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 ref|XP_004149431.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >gb|EOY16398.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724502|gb|EOY16399.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724503|gb|EOY16400.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724504|gb|EOY16401.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508724505|gb|EOY16402.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 480 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/58 (44%), Positives = 41/58 (70%) Frame = -3 Query: 175 VPNTLVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 VP +V+ LK F+ AGML YR F WAEKQ Y +++ AY ++++SL + R+Y+++W Sbjct: 61 VPPEVVEDVLKRFENAGMLAYRFFEWAEKQRNY-MHSIRAYHTMIESLAKIRQYQIMW 117 >ref|XP_002307458.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550339385|gb|EEE94454.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 478 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/58 (44%), Positives = 40/58 (68%) Frame = -3 Query: 175 VPNTLVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 V +VD LK F+ AGM+ YR F WAEKQ Y +++ A+ +++DSL + R+Y+L+W Sbjct: 58 VSEQIVDDVLKKFENAGMVAYRFFEWAEKQRHYN-HSVKAFHTVIDSLAKIRQYQLMW 114 >ref|XP_003526650.2| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X1 [Glycine max] Length = 454 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -3 Query: 163 LVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 LV+ LK F+ AGM +R F WAEKQ GY +++ AY +++SL + R+Y++VW Sbjct: 39 LVENVLKRFENAGMPAFRFFEWAEKQRGYS-HSIRAYHLMIESLAKIRQYQIVW 91 >ref|XP_006581591.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X2 [Glycine max] gi|571460055|ref|XP_006581592.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X3 [Glycine max] gi|571460057|ref|XP_006581593.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X4 [Glycine max] gi|571460059|ref|XP_006581594.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X5 [Glycine max] gi|571460061|ref|XP_006581595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like isoform X6 [Glycine max] Length = 481 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -3 Query: 163 LVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 LV+ LK F+ AGM +R F WAEKQ GY +++ AY +++SL + R+Y++VW Sbjct: 66 LVENVLKRFENAGMPAFRFFEWAEKQRGYS-HSIRAYHLMIESLAKIRQYQIVW 118 >gb|ESW09460.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] gi|561010554|gb|ESW09461.1| hypothetical protein PHAVU_009G129200g [Phaseolus vulgaris] Length = 480 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/54 (44%), Positives = 38/54 (70%) Frame = -3 Query: 163 LVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 LV+ LK F+ AGM +R F W+EKQ GY +++ AY +++SL + R+Y++VW Sbjct: 65 LVENVLKRFENAGMSAFRFFEWSEKQRGYS-HSIRAYHLMIESLAKIRQYQIVW 117 >ref|XP_006340242.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Solanum tuberosum] Length = 478 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -3 Query: 163 LVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 +V+ LK F+ AGML YR F WA KQ Y +T AY S++ SL + R+Y+++W Sbjct: 63 MVEDVLKRFENAGMLAYRFFEWAGKQHNYEHST-RAYHSMIGSLAKIRQYQMMW 115 >ref|XP_004251179.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Solanum lycopersicum] Length = 478 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -3 Query: 163 LVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 +V+ LK F+ AGML YR F WA KQ Y +T AY S++ SL + R+Y+++W Sbjct: 63 MVEDVLKRFENAGMLAYRFFEWAGKQHNYEHST-RAYHSMIGSLAKIRQYQMMW 115 >ref|XP_004149431.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] gi|449499065|ref|XP_004160711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77360, mitochondrial-like [Cucumis sativus] Length = 439 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/54 (42%), Positives = 37/54 (68%) Frame = -3 Query: 163 LVDQTLKTFDKAGMLGYRLFRWAEKQPGYGFNTLAAYESIVDSLTRDRRYRLVW 2 + + L+ F+ AGML YR F WA KQ Y +++ AY S+++SL + R+Y++VW Sbjct: 24 IAEPVLRRFENAGMLAYRFFEWASKQRNY-VHSVRAYHSMIESLAKIRQYQMVW 76