BLASTX nr result
ID: Ephedra26_contig00026311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00026311 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR17922.1| unknown [Picea sitchensis] 82 2e-27 gb|ADM74541.1| thaumatin-like protein [Picea sitchensis] gi|3060... 82 2e-27 gb|ADM74521.1| thaumatin-like protein [Picea sitchensis] gi|3060... 82 2e-27 gb|ADM74537.1| thaumatin-like protein [Picea sitchensis] gi|3060... 82 2e-27 gb|ADM77976.1| thaumatin-like protein [Picea sitchensis] 86 3e-27 gb|ADM77965.1| thaumatin-like protein [Picea sitchensis] 86 3e-27 gb|ADM77951.1| thaumatin-like protein [Picea sitchensis] gi|3060... 86 3e-27 gb|ADM77948.1| thaumatin-like protein [Picea sitchensis] gi|3060... 86 3e-27 gb|ABK25464.1| unknown [Picea sitchensis] 86 1e-26 gb|ADM77973.1| thaumatin-like protein [Picea sitchensis] 86 1e-26 gb|ADM77971.1| thaumatin-like protein [Picea sitchensis] 86 1e-26 gb|ADM77961.1| thaumatin-like protein [Picea sitchensis] gi|3060... 86 1e-26 gb|ADM77950.1| thaumatin-like protein [Picea sitchensis] gi|3060... 86 1e-26 gb|ADM77944.1| thaumatin-like protein [Picea sitchensis] gi|3060... 86 1e-26 gb|ADR80225.1| thaumatin-like protein [Sequoia sempervirens] 80 5e-26 gb|ADB97926.1| thaumatin-like protein L2 [Pinus monticola] 82 8e-26 gb|ADB97929.1| thaumatin-like protein L5 [Pinus monticola] 78 8e-26 gb|ADB97930.1| thaumatin-like protein L6 [Pinus monticola] 78 4e-25 gb|ADB97927.1| thaumatin-like protein L3 [Pinus monticola] 80 5e-25 dbj|BAC15615.1| thaumatin-like protein [Cryptomeria japonica] 76 1e-24 >gb|ABR17922.1| unknown [Picea sitchensis] Length = 243 Score = 82.4 bits (202), Expect(3) = 2e-27 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C+ DINS CP +L+ GCKS C AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 144 KVRCSSDINSKCPAELRVADGCKSACAAFNTPQYCCTGSFLDNCPPTDYSRFFKGEC 200 Score = 56.6 bits (135), Expect(3) = 2e-27 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 VL CQ + GN TLAEYALNQ D YDISLVDGFN+PM ++PS C Sbjct: 94 VLNCQGW-GNVPATLAEYALNQY-QNLDFYDISLVDGFNLPMIMIPSASQC 142 Score = 29.6 bits (65), Expect(3) = 2e-27 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 214 TFTCPGGTNYKVVFCG 229 >gb|ADM74541.1| thaumatin-like protein [Picea sitchensis] gi|306010977|gb|ADM74542.1| thaumatin-like protein [Picea sitchensis] Length = 173 Score = 82.4 bits (202), Expect(3) = 2e-27 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C+ DINS CP +L+ GCKS C AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 86 KVRCSSDINSKCPAELKVADGCKSACAAFNTPQYCCTGSFLDNCPPTDYSRFFKGEC 142 Score = 56.6 bits (135), Expect(3) = 2e-27 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 VL CQ + GN TLAEYALNQ D YDISLVDGFN+PM ++PS C Sbjct: 36 VLNCQGW-GNVPATLAEYALNQY-QNLDFYDISLVDGFNLPMIMIPSASQC 84 Score = 29.6 bits (65), Expect(3) = 2e-27 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 156 TFTCPGGTNYKVVFCG 171 >gb|ADM74521.1| thaumatin-like protein [Picea sitchensis] gi|306010937|gb|ADM74522.1| thaumatin-like protein [Picea sitchensis] gi|306010939|gb|ADM74523.1| thaumatin-like protein [Picea sitchensis] gi|306010941|gb|ADM74524.1| thaumatin-like protein [Picea sitchensis] gi|306010943|gb|ADM74525.1| thaumatin-like protein [Picea sitchensis] gi|306010945|gb|ADM74526.1| thaumatin-like protein [Picea sitchensis] gi|306010947|gb|ADM74527.1| thaumatin-like protein [Picea sitchensis] gi|306010949|gb|ADM74528.1| thaumatin-like protein [Picea sitchensis] gi|306010951|gb|ADM74529.1| thaumatin-like protein [Picea sitchensis] gi|306010953|gb|ADM74530.1| thaumatin-like protein [Picea sitchensis] gi|306010955|gb|ADM74531.1| thaumatin-like protein [Picea sitchensis] gi|306010957|gb|ADM74532.1| thaumatin-like protein [Picea sitchensis] gi|306010959|gb|ADM74533.1| thaumatin-like protein [Picea sitchensis] gi|306010961|gb|ADM74534.1| thaumatin-like protein [Picea sitchensis] gi|306010963|gb|ADM74535.1| thaumatin-like protein [Picea sitchensis] gi|306010965|gb|ADM74536.1| thaumatin-like protein [Picea sitchensis] gi|306010971|gb|ADM74539.1| thaumatin-like protein [Picea sitchensis] gi|306010973|gb|ADM74540.1| thaumatin-like protein [Picea sitchensis] gi|306010979|gb|ADM74543.1| thaumatin-like protein [Picea sitchensis] gi|306010981|gb|ADM74544.1| thaumatin-like protein [Picea sitchensis] gi|306010983|gb|ADM74545.1| thaumatin-like protein [Picea sitchensis] gi|306010985|gb|ADM74546.1| thaumatin-like protein [Picea sitchensis] gi|306010987|gb|ADM74547.1| thaumatin-like protein [Picea sitchensis] gi|306010989|gb|ADM74548.1| thaumatin-like protein [Picea sitchensis] gi|306010991|gb|ADM74549.1| thaumatin-like protein [Picea sitchensis] gi|306010993|gb|ADM74550.1| thaumatin-like protein [Picea sitchensis] Length = 173 Score = 82.4 bits (202), Expect(3) = 2e-27 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C+ DINS CP +L+ GCKS C AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 86 KVRCSSDINSKCPAELRVADGCKSACAAFNTPQYCCTGSFLDNCPPTDYSRFFKGEC 142 Score = 56.6 bits (135), Expect(3) = 2e-27 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 VL CQ + GN TLAEYALNQ D YDISLVDGFN+PM ++PS C Sbjct: 36 VLNCQGW-GNVPATLAEYALNQY-QNLDFYDISLVDGFNLPMIMIPSASQC 84 Score = 29.6 bits (65), Expect(3) = 2e-27 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 156 TFTCPGGTNYKVVFCG 171 >gb|ADM74537.1| thaumatin-like protein [Picea sitchensis] gi|306010969|gb|ADM74538.1| thaumatin-like protein [Picea sitchensis] gi|306010995|gb|ADM74551.1| thaumatin-like protein [Picea sitchensis] gi|306010997|gb|ADM74552.1| thaumatin-like protein [Picea sitchensis] Length = 173 Score = 82.0 bits (201), Expect(3) = 2e-27 Identities = 33/57 (57%), Positives = 40/57 (70%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C+ DINS CP +L+ GCKS C AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 86 KVRCSSDINSKCPAELRVADGCKSACAAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 142 Score = 56.6 bits (135), Expect(3) = 2e-27 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 VL CQ + GN TLAEYALNQ D YDISLVDGFN+PM ++PS C Sbjct: 36 VLNCQGW-GNVPATLAEYALNQY-QNLDFYDISLVDGFNLPMIMIPSASQC 84 Score = 29.6 bits (65), Expect(3) = 2e-27 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 156 TFTCPGGTNYKVVFCG 171 >gb|ADM77976.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 3e-27 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 3e-27 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 31.6 bits (70), Expect(3) = 3e-27 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G DYKV FCG Sbjct: 209 TFTCPGGTDYKVVFCG 224 >gb|ADM77965.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 3e-27 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 3e-27 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 31.6 bits (70), Expect(3) = 3e-27 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G DYKV FCG Sbjct: 209 TFTCPGGTDYKVVFCG 224 >gb|ADM77951.1| thaumatin-like protein [Picea sitchensis] gi|306017821|gb|ADM77964.1| thaumatin-like protein [Picea sitchensis] gi|306017847|gb|ADM77977.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 3e-27 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 3e-27 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 31.6 bits (70), Expect(3) = 3e-27 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G DYKV FCG Sbjct: 209 TFTCPGGTDYKVVFCG 224 >gb|ADM77948.1| thaumatin-like protein [Picea sitchensis] gi|306017829|gb|ADM77968.1| thaumatin-like protein [Picea sitchensis] gi|306017837|gb|ADM77972.1| thaumatin-like protein [Picea sitchensis] gi|306017851|gb|ADM77979.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 3e-27 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 3e-27 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 31.6 bits (70), Expect(3) = 3e-27 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G DYKV FCG Sbjct: 209 TFTCPGGTDYKVVFCG 224 >gb|ABK25464.1| unknown [Picea sitchensis] Length = 240 Score = 86.3 bits (212), Expect(3) = 1e-26 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 142 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 198 Score = 49.7 bits (117), Expect(3) = 1e-26 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 92 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 140 Score = 29.6 bits (65), Expect(3) = 1e-26 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 212 TFTCPGGTNYKVVFCG 227 >gb|ADM77973.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 1e-26 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 1e-26 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 29.6 bits (65), Expect(3) = 1e-26 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 209 TFTCPGGTNYKVVFCG 224 >gb|ADM77971.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 1e-26 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 1e-26 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 29.6 bits (65), Expect(3) = 1e-26 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 209 TFTCPGGTNYKVVFCG 224 >gb|ADM77961.1| thaumatin-like protein [Picea sitchensis] gi|306017819|gb|ADM77963.1| thaumatin-like protein [Picea sitchensis] gi|306017825|gb|ADM77966.1| thaumatin-like protein [Picea sitchensis] gi|306017843|gb|ADM77975.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 1e-26 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 1e-26 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 29.6 bits (65), Expect(3) = 1e-26 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 209 TFTCPGGTNYKVVFCG 224 >gb|ADM77950.1| thaumatin-like protein [Picea sitchensis] gi|306017797|gb|ADM77952.1| thaumatin-like protein [Picea sitchensis] gi|306017799|gb|ADM77953.1| thaumatin-like protein [Picea sitchensis] gi|306017801|gb|ADM77954.1| thaumatin-like protein [Picea sitchensis] gi|306017803|gb|ADM77955.1| thaumatin-like protein [Picea sitchensis] gi|306017805|gb|ADM77956.1| thaumatin-like protein [Picea sitchensis] gi|306017807|gb|ADM77957.1| thaumatin-like protein [Picea sitchensis] gi|306017809|gb|ADM77958.1| thaumatin-like protein [Picea sitchensis] gi|306017811|gb|ADM77959.1| thaumatin-like protein [Picea sitchensis] gi|306017813|gb|ADM77960.1| thaumatin-like protein [Picea sitchensis] gi|306017817|gb|ADM77962.1| thaumatin-like protein [Picea sitchensis] gi|306017827|gb|ADM77967.1| thaumatin-like protein [Picea sitchensis] gi|306017841|gb|ADM77974.1| thaumatin-like protein [Picea sitchensis] gi|306017849|gb|ADM77978.1| thaumatin-like protein [Picea sitchensis] gi|306017853|gb|ADM77980.1| thaumatin-like protein [Picea sitchensis] gi|306017855|gb|ADM77981.1| thaumatin-like protein [Picea sitchensis] gi|306017857|gb|ADM77982.1| thaumatin-like protein [Picea sitchensis] gi|306017859|gb|ADM77983.1| thaumatin-like protein [Picea sitchensis] gi|306017861|gb|ADM77984.1| thaumatin-like protein [Picea sitchensis] gi|306017863|gb|ADM77985.1| thaumatin-like protein [Picea sitchensis] gi|306017865|gb|ADM77986.1| thaumatin-like protein [Picea sitchensis] gi|306017867|gb|ADM77987.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 1e-26 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 1e-26 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 29.6 bits (65), Expect(3) = 1e-26 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 209 TFTCPGGTNYKVVFCG 224 >gb|ADM77944.1| thaumatin-like protein [Picea sitchensis] gi|306017783|gb|ADM77945.1| thaumatin-like protein [Picea sitchensis] gi|306017785|gb|ADM77946.1| thaumatin-like protein [Picea sitchensis] gi|306017787|gb|ADM77947.1| thaumatin-like protein [Picea sitchensis] gi|306017791|gb|ADM77949.1| thaumatin-like protein [Picea sitchensis] gi|306017831|gb|ADM77969.1| thaumatin-like protein [Picea sitchensis] gi|306017833|gb|ADM77970.1| thaumatin-like protein [Picea sitchensis] Length = 226 Score = 86.3 bits (212), Expect(3) = 1e-26 Identities = 35/57 (61%), Positives = 41/57 (71%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K C+ DINS CP +L+ P GCKSPC AF TPQY CTG F NCPPT+YS F+ +C Sbjct: 139 KSVCSSDINSKCPTELRVPDGCKSPCVAFNTPQYCCTGSFLDNCPPTDYSRFFKREC 195 Score = 49.7 bits (117), Expect(3) = 1e-26 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G +LAE+A+NQ +K D YDISLVDGFN+P+S++PS C Sbjct: 89 LLNCQGS-GGVPASLAEFAVNQFENK-DFYDISLVDGFNLPLSIIPSNNQC 137 Score = 29.6 bits (65), Expect(3) = 1e-26 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 209 TFTCPGGTNYKVVFCG 224 >gb|ADR80225.1| thaumatin-like protein [Sequoia sempervirens] Length = 232 Score = 79.7 bits (195), Expect(3) = 5e-26 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 +++C DINS CP +L+ GGCKS C + TPQY CTG + +NC PTNYS F+ QC Sbjct: 147 RITCLSDINSKCPSELKVKGGCKSACARYNTPQYCCTGAYLNNCSPTNYSKFFKGQC 203 Score = 53.1 bits (126), Expect(3) = 5e-26 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPS 268 +L C+ Y GN TLAEYALNQ D YDISLVDGFN+P+S+ P+ Sbjct: 94 LLNCKGY-GNVPATLAEYALNQY-QNLDFYDISLVDGFNLPLSMTPT 138 Score = 30.8 bits (68), Expect(3) = 5e-26 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP+G +YKV FCG Sbjct: 217 TFTCPSGTNYKVVFCG 232 >gb|ADB97926.1| thaumatin-like protein L2 [Pinus monticola] Length = 234 Score = 81.6 bits (200), Expect(3) = 8e-26 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C +IN++CP QL+ GCKS C AF TPQY CTG + +NC PTNYS F+ QC Sbjct: 149 KIGCTSNINAICPSQLKVTDGCKSACAAFNTPQYCCTGAYLNNCSPTNYSKFFKQQC 205 Score = 53.5 bits (127), Expect(3) = 8e-26 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ Y G+ TL EYALNQ ++ D YDISLVDGFN+P+S PS C Sbjct: 99 LLNCQGY-GSVPATLFEYALNQYQNQ-DFYDISLVDGFNIPLSATPSNSNC 147 Score = 27.7 bits (60), Expect(3) = 8e-26 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP+G ++ V FCG Sbjct: 219 TFTCPSGANHNVVFCG 234 >gb|ADB97929.1| thaumatin-like protein L5 [Pinus monticola] Length = 233 Score = 77.8 bits (190), Expect(3) = 8e-26 Identities = 31/57 (54%), Positives = 39/57 (68%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C +IN++CP QL+ GCKS AF TPQY CTG + +NC PTNYS F+ QC Sbjct: 148 KIGCTSNINAICPSQLKVTDGCKSASAAFNTPQYCCTGAYINNCSPTNYSKFFKQQC 204 Score = 55.5 bits (132), Expect(3) = 8e-26 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ Y G+ TL EYALNQ+ ++ D YDISLVDGFNVP+S PS C Sbjct: 98 LLNCQGY-GSVPATLFEYALNQNQNR-DFYDISLVDGFNVPLSATPSNSNC 146 Score = 29.6 bits (65), Expect(3) = 8e-26 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP+G +Y V FCG Sbjct: 218 TFTCPSGANYNVVFCG 233 >gb|ADB97930.1| thaumatin-like protein L6 [Pinus monticola] Length = 234 Score = 78.2 bits (191), Expect(3) = 4e-25 Identities = 30/57 (52%), Positives = 39/57 (68%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 K+ C +IN++CP QL+ GCKS C F +PQY CTG + +NC PTNYS F+ QC Sbjct: 149 KIGCTSNINAICPSQLKVTDGCKSACAQFNSPQYCCTGAYLNNCSPTNYSKFFKQQC 205 Score = 52.8 bits (125), Expect(3) = 4e-25 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ Y G+ TL EYALNQ ++ D YDISLVDGFN+P+S PS C Sbjct: 99 LLNCQGY-GSVPATLFEYALNQYQNQ-DFYDISLVDGFNIPLSATPSNSKC 147 Score = 29.6 bits (65), Expect(3) = 4e-25 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP+G +Y V FCG Sbjct: 219 TFTCPSGANYNVVFCG 234 >gb|ADB97927.1| thaumatin-like protein L3 [Pinus monticola] Length = 234 Score = 79.7 bits (195), Expect(3) = 5e-25 Identities = 33/62 (53%), Positives = 41/62 (66%) Frame = -2 Query: 268 HGWMPKLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRA 89 +G K C+ DINS CP +L+ GCKS C AF TPQY CTG F NCPP++YS F+ Sbjct: 137 NGQCTKSICSSDINSKCPAELKVSDGCKSACVAFNTPQYCCTGSFLDNCPPSDYSRFFKK 196 Query: 88 QC 83 +C Sbjct: 197 EC 198 Score = 50.8 bits (120), Expect(3) = 5e-25 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = -3 Query: 408 VLRCQVYIGNGTT--TLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPSMVGC 256 +L CQ G+G+ TLAE+A+NQ D YD+SLVDGFN+PMS++PS C Sbjct: 92 LLNCQ---GSGSVPATLAEFAVNQF-QNLDFYDVSLVDGFNLPMSIIPSNGQC 140 Score = 29.6 bits (65), Expect(3) = 5e-25 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP G +YKV FCG Sbjct: 212 TFTCPGGTNYKVVFCG 227 >dbj|BAC15615.1| thaumatin-like protein [Cryptomeria japonica] Length = 233 Score = 75.9 bits (185), Expect(3) = 1e-24 Identities = 31/57 (54%), Positives = 39/57 (68%) Frame = -2 Query: 253 KLSCNKDINSVCPPQLQAPGGCKSPCQAFGTPQY*CTGPFASNCPPTNYSMIFRAQC 83 +++C DINS CP +L+ GGCKS C + T QY CTG A+NC PTNYS F+ QC Sbjct: 148 RITCLSDINSKCPSELKVNGGCKSACARYNTAQYCCTGASANNCGPTNYSKFFKGQC 204 Score = 52.4 bits (124), Expect(3) = 1e-24 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 408 VLRCQVYIGNGTTTLAEYALNQSGSKTDVYDISLVDGFNVPMSLVPS 268 +L CQ Y G TLAEYALNQ D YDISLVDGFNVP+S+ P+ Sbjct: 95 MLSCQGY-GQVPATLAEYALNQY-MNLDFYDISLVDGFNVPISMTPT 139 Score = 30.8 bits (68), Expect(3) = 1e-24 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 59 TLTCPTGGDYKVFFCG 12 T TCP+G +YKV FCG Sbjct: 218 TFTCPSGTNYKVVFCG 233