BLASTX nr result
ID: Ephedra26_contig00025376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00025376 (495 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB53232.1| hypothetical protein L484_007175 [Morus notabilis] 54 2e-09 ref|XP_004144748.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006492325.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006444484.1| hypothetical protein CICLE_v10019225mg [Citr... 59 9e-07 ref|XP_004230081.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_002515292.1| pentatricopeptide repeat-containing protein,... 59 9e-07 ref|XP_006347731.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|EOY32024.1| Pentatricopeptide repeat (PPR) superfamily protei... 57 3e-06 emb|CBI20034.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002268129.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 emb|CAN78368.1| hypothetical protein VITISV_028672 [Vitis vinifera] 57 3e-06 gb|EPS71818.1| hypothetical protein M569_02938 [Genlisea aurea] 57 3e-06 gb|ESW20009.1| hypothetical protein PHAVU_006G173400g [Phaseolus... 56 4e-06 gb|ESW20008.1| hypothetical protein PHAVU_006G173400g [Phaseolus... 56 4e-06 ref|XP_004486276.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_003566348.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_002320305.2| hypothetical protein POPTR_0014s11650g, part... 55 1e-05 ref|XP_004962378.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-05 >gb|EXB53232.1| hypothetical protein L484_007175 [Morus notabilis] Length = 567 Score = 54.3 bits (129), Expect(2) = 2e-09 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W V N+ EAG L N+M+D FKPD++AH ML+GLL+ Sbjct: 256 FTPNLQTYTVLLNGWCRVKNLMEAGRLWNEMIDAGFKPDVVAHTIMLEGLLR 307 Score = 32.7 bits (73), Expect(2) = 2e-09 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -3 Query: 478 KYGEQAFKMLNLMQKHRMCPDIDAFNLLLFFLGRSRLAYDAPYSLE 341 K ++A M LM+K++ +D FN LL LG++RL +A E Sbjct: 205 KERKKAVGMFELMKKYKFKVGVDTFNFLLDTLGKARLGKEAQVLFE 250 >ref|XP_004144748.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cucumis sativus] gi|449490811|ref|XP_004158714.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cucumis sativus] Length = 621 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W V N+ EAG + NQM+D+DFKPDI+AHN ML+GLL+ Sbjct: 308 FTPNLQTYTVLLNGWCRVRNLMEAGKIWNQMIDEDFKPDIVAHNTMLEGLLR 359 >ref|XP_006492325.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Citrus sinensis] Length = 651 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/54 (50%), Positives = 38/54 (70%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLKGG 165 + PN +L+ +W V N+ EAG + N+M+DK FKPD++AHN ML+GLLK G Sbjct: 344 FTPNLTTYTVLLGSWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIG 397 >ref|XP_006444484.1| hypothetical protein CICLE_v10019225mg [Citrus clementina] gi|557546746|gb|ESR57724.1| hypothetical protein CICLE_v10019225mg [Citrus clementina] Length = 653 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLKGG 165 + PN +L+ W V N+ EAG + N+M+DK FKPD++AHN ML+GLLK G Sbjct: 346 FTPNLTTYTVLLGGWCRVKNLMEAGRVWNEMIDKGFKPDVVAHNIMLEGLLKIG 399 >ref|XP_004230081.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Solanum lycopersicum] Length = 691 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W V N+ +AG + N+M+DK FKPDI+AHN ML+GLLK Sbjct: 387 FTPNLQTYTVLLNGWCRVKNLMDAGKVWNEMIDKGFKPDIVAHNTMLEGLLK 438 >ref|XP_002515292.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223545772|gb|EEF47276.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 533 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W V N+ EAG + N+M+DK FKPDI+AHN ML+GLL+ Sbjct: 228 FTPNLRTYTVLLNGWCKVKNLMEAGSVWNEMIDKGFKPDIVAHNIMLEGLLR 279 >ref|XP_006347731.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Solanum tuberosum] Length = 687 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN +L+ W V N+ +AG + N+M+DK FKPDI+AHN ML+GLLK Sbjct: 383 FTPNLLTYTVLLNGWCRVKNLMDAGKVWNEMIDKGFKPDIVAHNTMLEGLLK 434 >gb|EOY32024.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 627 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN IL+ W V N+ EAG + N+M+DK FKPDI+AHN M++GLL+ Sbjct: 316 FTPNLSTYTILLNGWCRVRNLMEAGRVWNEMLDKGFKPDIVAHNVMIEGLLR 367 >emb|CBI20034.3| unnamed protein product [Vitis vinifera] Length = 596 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W + N+ EAG N+M+DK FKPDIIAH+ ML+GLLK Sbjct: 323 FTPNLRTYTVLLNGWCRIKNLVEAGRTWNEMIDKGFKPDIIAHHTMLEGLLK 374 >ref|XP_002268129.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Vitis vinifera] Length = 679 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W + N+ EAG N+M+DK FKPDIIAH+ ML+GLLK Sbjct: 368 FTPNLRTYTVLLNGWCRIKNLVEAGRTWNEMIDKGFKPDIIAHHTMLEGLLK 419 >emb|CAN78368.1| hypothetical protein VITISV_028672 [Vitis vinifera] Length = 927 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W + N+ EAG N+M+DK FKPDIIAH+ ML+GLLK Sbjct: 368 FTPNLRTYTVLLNGWCRIKNLVEAGRTWNEMIDKGFKPDIIAHHTMLEGLLK 419 >gb|EPS71818.1| hypothetical protein M569_02938 [Genlisea aurea] Length = 471 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/53 (45%), Positives = 37/53 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLKG 168 + P+S+ IL+ W V N+ EAG + N+M+D F PD+IAHN M++GL++G Sbjct: 166 FTPDSRTYTILLSGWCRVRNLMEAGRIWNEMIDAGFHPDVIAHNTMIEGLIRG 218 >gb|ESW20009.1| hypothetical protein PHAVU_006G173400g [Phaseolus vulgaris] Length = 638 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + IL+ W + N+ EAG + N+M+D FKPDI+AHN ML+GLLK Sbjct: 327 FTPNLQTYTILLSGWCRLKNLLEAGKVWNEMIDGGFKPDIVAHNVMLEGLLK 378 >gb|ESW20008.1| hypothetical protein PHAVU_006G173400g [Phaseolus vulgaris] Length = 458 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + IL+ W + N+ EAG + N+M+D FKPDI+AHN ML+GLLK Sbjct: 147 FTPNLQTYTILLSGWCRLKNLLEAGKVWNEMIDGGFKPDIVAHNVMLEGLLK 198 >ref|XP_004486276.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Cicer arietinum] Length = 685 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 ++PN + IL+ W V N+ EAG + N+M+DK F PDI+AHN ML GLL+ Sbjct: 374 FVPNLQTYTILLNGWCRVRNLLEAGTVWNEMIDKGFMPDIVAHNIMLVGLLR 425 >ref|XP_003566348.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Brachypodium distachyon] Length = 649 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/53 (45%), Positives = 35/53 (66%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLKG 168 Y P+ + L+L W N N+ EAG + N M++K KPD++ HN M+DGLL+G Sbjct: 337 YTPDLRSYTALMLAWCNARNLVEAGRVWNDMLEKGMKPDVVVHNTMIDGLLRG 389 >ref|XP_002320305.2| hypothetical protein POPTR_0014s11650g, partial [Populus trichocarpa] gi|550324008|gb|EEE98620.2| hypothetical protein POPTR_0014s11650g, partial [Populus trichocarpa] Length = 614 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLK 171 + PN + +L+ W V N+ EAG + N+M+D+ FKPDI+ HN ML+GLL+ Sbjct: 311 FTPNLRTYTVLLNGWCRVKNLMEAGRIWNEMLDEGFKPDIVTHNIMLEGLLR 362 >ref|XP_004962378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62470, mitochondrial-like [Setaria italica] Length = 623 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/53 (43%), Positives = 36/53 (67%) Frame = -2 Query: 326 YIPNSKI*CILILTWRNVINIKEAGLL*NQMVDKDFKPDIIAHNAMLDGLLKG 168 Y P+ + L+L W N N+ EAG + N+M++K KPD++ HN M++GLL+G Sbjct: 311 YTPDLRSYTALMLAWCNAKNLVEAGRVWNEMLEKGMKPDVVVHNTMIEGLLRG 363