BLASTX nr result
ID: Ephedra26_contig00025358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00025358 (468 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002972071.1| hypothetical protein SELMODRAFT_96774 [Selag... 82 1e-13 ref|XP_001751919.1| predicted protein [Physcomitrella patens] gi... 63 4e-08 >ref|XP_002972071.1| hypothetical protein SELMODRAFT_96774 [Selaginella moellendorffii] gi|300160370|gb|EFJ26988.1| hypothetical protein SELMODRAFT_96774 [Selaginella moellendorffii] Length = 192 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/57 (66%), Positives = 46/57 (80%) Frame = -3 Query: 460 GKYIATYLLWRVHNGAIIVLHDRREQAKQTPEILRYFLPQLRAQGYSLVTLTELLHI 290 GK IA YLLWRVH GAIIVLHDR +Q QTPE+LR LP+L+ +GYS+VT+ ELL + Sbjct: 135 GKLIAKYLLWRVHPGAIIVLHDREQQKIQTPEVLRVLLPELKRKGYSVVTIPELLKL 191 >ref|XP_001751919.1| predicted protein [Physcomitrella patens] gi|162697017|gb|EDQ83354.1| predicted protein [Physcomitrella patens] Length = 486 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 439 LLWRVHNGAIIVLHDRREQAKQTPEILRYFLPQLRAQGYSLVTLTEL 299 LLWR+H GA+I+LHDR Q QTP +LR LP+LR +GY +V+L+EL Sbjct: 368 LLWRIHPGAVIILHDRVPQWAQTPLVLRLLLPELRKRGYRVVSLSEL 414