BLASTX nr result
ID: Ephedra26_contig00025281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00025281 (632 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002978662.1| sensory histidine protein kinase [Selaginell... 64 3e-08 >ref|XP_002978662.1| sensory histidine protein kinase [Selaginella moellendorffii] gi|300153471|gb|EFJ20109.1| sensory histidine protein kinase [Selaginella moellendorffii] Length = 984 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +2 Query: 482 KWLVINIMIACIYVATGKLSDMLAILKSTASPIWVPSGIVAAFVLIFGY 628 +WL +N I +Y+ TGKLSD L+++++ ASPIW PSG++ A VLI GY Sbjct: 6 RWLAVNAAIMWLYIGTGKLSDTLSVVRAQASPIWAPSGLMVALVLIVGY 54