BLASTX nr result
ID: Ephedra26_contig00025072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00025072 (595 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004032416.1| hypothetical protein IMG5_123010, partial [I... 62 1e-07 ref|XP_006481069.1| PREDICTED: uncharacterized protein LOC102617... 61 3e-07 ref|XP_006429437.1| hypothetical protein CICLE_v10011366mg [Citr... 60 3e-07 gb|EXB52381.1| DnaJ homolog subfamily C member 16 [Morus notabilis] 60 4e-07 gb|EPS65456.1| hypothetical protein M569_09321, partial [Genlise... 60 6e-07 ref|XP_002258684.1| DnaJ protein [Plasmodium knowlesi strain H] ... 60 6e-07 ref|WP_016565041.1| chaperone protein DnaJ [Clostridium sp. CAG:... 59 1e-06 ref|XP_002322996.2| hypothetical protein POPTR_0016s12750g [Popu... 59 1e-06 ref|WP_020531622.1| hypothetical protein [Flexithrix dorotheae] 59 1e-06 ref|YP_270483.1| chaperone protein DnaJ [Colwellia psychrerythra... 59 1e-06 ref|XP_002364551.1| DnaJ domain-containing protein [Toxoplasma g... 59 1e-06 gb|EOY07141.1| DNAJ heat shock N-terminal domain-containing prot... 58 2e-06 gb|EMJ09907.1| hypothetical protein PRUPE_ppa003438mg [Prunus pe... 58 2e-06 ref|WP_008913298.1| chaperone protein DnaJ [Providencia burhodog... 58 2e-06 ref|XP_003646186.1| hypothetical protein Ecym_4306 [Eremothecium... 58 2e-06 ref|WP_019025721.1| molecular chaperone DnaJ [Colwellia piezophila] 58 2e-06 gb|EKD55343.1| hypothetical protein ACD_60C00014G0017 [unculture... 58 2e-06 gb|ESW12234.1| hypothetical protein PHAVU_008G095600g [Phaseolus... 57 3e-06 ref|XP_004302542.1| PREDICTED: putative protein disulfide-isomer... 57 3e-06 ref|WP_009767016.1| chaperone protein DnaJ [Moraxella macacae] g... 57 3e-06 >ref|XP_004032416.1| hypothetical protein IMG5_123010, partial [Ichthyophthirius multifiliis] gi|340504381|gb|EGR30829.1| hypothetical protein IMG5_123010 [Ichthyophthirius multifiliis] Length = 440 Score = 62.0 bits (149), Expect = 1e-07 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 1/101 (0%) Frame = -3 Query: 482 HLANNFSQK-CWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKEC 306 +++N QK C+Y+TLG+ +NA ++I KL L +HPDK +K K+ +K+ Sbjct: 18 NMSNKSQQKECYYKTLGINKNAKEEQIKKAYKKLALQWHPDKNQNK---KDEATTKFKQI 74 Query: 305 NNAKDILADERKRAAYDHVHLYHCAQHRKQHTERTNRLGIQ 183 + A +IL+D +KRAAYD Q +Q + N+ Q Sbjct: 75 SEAYEILSDSQKRAAYDRYGFDGLGQGAQQQNYQFNQQNYQ 115 >ref|XP_006481069.1| PREDICTED: uncharacterized protein LOC102617203 [Citrus sinensis] Length = 577 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA+ +EI KL L YHPDK +K+ Q++ + E NNA DIL+DE K Sbjct: 33 YKVLGVERNASQREIQKAFHKLSLQYHPDKNKNKAAQEK-----FAEINNAYDILSDEEK 87 Query: 269 RAAYD 255 R YD Sbjct: 88 RKKYD 92 >ref|XP_006429437.1| hypothetical protein CICLE_v10011366mg [Citrus clementina] gi|557531494|gb|ESR42677.1| hypothetical protein CICLE_v10011366mg [Citrus clementina] Length = 577 Score = 60.5 bits (145), Expect = 3e-07 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA+ +EI KL L YHPDK +K+ Q++ + E NNA DIL+DE K Sbjct: 33 YKVLGVERNASQREIQKAFHKLSLQYHPDKNKNKAAQEK-----FAEINNAYDILSDEEK 87 Query: 269 RAAYD 255 R YD Sbjct: 88 RKNYD 92 >gb|EXB52381.1| DnaJ homolog subfamily C member 16 [Morus notabilis] Length = 570 Score = 60.1 bits (144), Expect = 4e-07 Identities = 32/65 (49%), Positives = 41/65 (63%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA+ +EI KL L YHPDK +K Q++ + E NNA DIL+DE K Sbjct: 28 YKVLGVERNASQREIQKAFHKLSLQYHPDKNKNKGAQEK-----FAEINNAYDILSDEEK 82 Query: 269 RAAYD 255 R YD Sbjct: 83 RKNYD 87 >gb|EPS65456.1| hypothetical protein M569_09321, partial [Genlisea aurea] Length = 518 Score = 59.7 bits (143), Expect = 6e-07 Identities = 32/64 (50%), Positives = 42/64 (65%) Frame = -3 Query: 446 QTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERKR 267 Q LGVE+NA+ +EI KL L YHPDK +K QK+ ++E NNA +IL+DE+KR Sbjct: 1 QVLGVERNASEREIQKAFHKLSLKYHPDKNKNKGAQKK-----FEEINNAYEILSDEQKR 55 Query: 266 AAYD 255 YD Sbjct: 56 KNYD 59 >ref|XP_002258684.1| DnaJ protein [Plasmodium knowlesi strain H] gi|193808754|emb|CAQ39456.1| DnaJ protein, putative [Plasmodium knowlesi strain H] Length = 713 Score = 59.7 bits (143), Expect = 6e-07 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 1/89 (1%) Frame = -3 Query: 458 KCWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVN-YKECNNAKDILA 282 KC+Y+ L VE A ++EI K++L YHPDK H S +++R N +++ A + L Sbjct: 7 KCFYEILNVESTATVEEIKKSYKKIILQYHPDKNSHLSEEEQRRCTNIFRQVQEAYECLV 66 Query: 281 DERKRAAYDHVHLYHCAQHRKQHTERTNR 195 DER+R YD L A + NR Sbjct: 67 DERRRKWYDKNRLRIIAGKENEEKRDQNR 95 >ref|WP_016565041.1| chaperone protein DnaJ [Clostridium sp. CAG:226] gi|514049339|emb|CCX49514.1| chaperone protein DnaJ [Clostridium sp. CAG:226] Length = 390 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = -3 Query: 452 WYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADER 273 +Y+ LGV +NA EI S KL YHPD +HK KE + +K+ N A ++L+D+ Sbjct: 5 YYELLGVNKNATDDEIKSAFRKLAKQYHPD--LHKGADKEEAEAKFKQINEAYEVLSDKE 62 Query: 272 KRAAYD 255 KRA YD Sbjct: 63 KRAKYD 68 >ref|XP_002322996.2| hypothetical protein POPTR_0016s12750g [Populus trichocarpa] gi|550321375|gb|EEF04757.2| hypothetical protein POPTR_0016s12750g [Populus trichocarpa] Length = 576 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/65 (47%), Positives = 41/65 (63%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA+ +EI KL L YHPDK +K Q++ + E NNA +IL+DE K Sbjct: 28 YKVLGVEKNASQREIQKAFHKLSLQYHPDKNKNKGAQEK-----FAEINNAYEILSDEEK 82 Query: 269 RAAYD 255 R YD Sbjct: 83 RKNYD 87 >ref|WP_020531622.1| hypothetical protein [Flexithrix dorotheae] Length = 405 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/85 (36%), Positives = 50/85 (58%) Frame = -3 Query: 452 WYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADER 273 +Y+ LG+ +N+ +EI S KL ++YHPDKT +E+ +K+ NNA IL+D + Sbjct: 5 YYKILGLSENSTQQEIKSAYKKLAVMYHPDKTGGNKAAEEK----FKQVNNAYQILSDPQ 60 Query: 272 KRAAYDHVHLYHCAQHRKQHTERTN 198 +RA YD + Y+ Q +T+ N Sbjct: 61 QRAQYDLLRNYYQFQATTTYTDFNN 85 >ref|YP_270483.1| chaperone protein DnaJ [Colwellia psychrerythraea 34H] gi|499355872|ref|WP_011044569.1| molecular chaperone DnaJ [Colwellia psychrerythraea] gi|123631394|sp|Q47XI7.1|DNAJ_COLP3 RecName: Full=Chaperone protein DnaJ gi|71147911|gb|AAZ28384.1| chaperone protein DnaJ [Colwellia psychrerythraea 34H] Length = 378 Score = 58.5 bits (140), Expect = 1e-06 Identities = 30/70 (42%), Positives = 46/70 (65%) Frame = -3 Query: 464 SQKCWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDIL 285 S++ +Y+TLGV Q+A+ KE+ KL + YHPD+T +++E +KE A +IL Sbjct: 2 SKRDYYETLGVSQDASEKEVKKAYKKLAMKYHPDRTQGDKSKEE----TFKEVKEAYEIL 57 Query: 284 ADERKRAAYD 255 D++KRAAYD Sbjct: 58 NDDQKRAAYD 67 >ref|XP_002364551.1| DnaJ domain-containing protein [Toxoplasma gondii ME49] Length = 401 Score = 58.5 bits (140), Expect = 1e-06 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 1/91 (1%) Frame = -3 Query: 524 KGLLERTKIPPMPVHLANNFSQ-KCWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHK 348 K L K+ P + +N++ +C+Y+ LGV + A EI KL + +HPDK I K Sbjct: 94 KALAAGRKVKGSPATMTSNYTPPRCYYEVLGVAKTATADEIKKSYRKLAIRWHPDKNIDK 153 Query: 347 STQKERLDVNYKECNNAKDILADERKRAAYD 255 K+ +KE + A ++L+D KR YD Sbjct: 154 ---KDEATARFKEISEAYEVLSDPEKRRRYD 181 >gb|EOY07141.1| DNAJ heat shock N-terminal domain-containing protein [Theobroma cacao] Length = 585 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/65 (47%), Positives = 40/65 (61%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA +EI KL L YHPDK ++ Q++ + E NNA DIL+DE K Sbjct: 29 YKVLGVEKNAGQREIQKAFHKLSLQYHPDKNKNQGAQEK-----FAEINNAYDILSDEEK 83 Query: 269 RAAYD 255 R YD Sbjct: 84 RKNYD 88 >gb|EMJ09907.1| hypothetical protein PRUPE_ppa003438mg [Prunus persica] Length = 574 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/65 (47%), Positives = 39/65 (60%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA+ +EI KL L YHPDK +K Q + E NNA +IL+DE K Sbjct: 28 YKVLGVERNASQREIQKAFHKLSLQYHPDKNKNKGAQ-----AKFSEINNAYEILSDEEK 82 Query: 269 RAAYD 255 R YD Sbjct: 83 RKNYD 87 >ref|WP_008913298.1| chaperone protein DnaJ [Providencia burhodogranariea] gi|414093754|gb|EKT55425.1| chaperone protein DnaJ [Providencia burhodogranariea DSM 19968] Length = 381 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/70 (40%), Positives = 47/70 (67%) Frame = -3 Query: 464 SQKCWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDIL 285 +++ +Y+ LG+E+NA+ K+I +L + YHPD+ K K+ +V +KE A +IL Sbjct: 2 AKRDFYEVLGLEKNASDKDIKKAYKRLAMKYHPDRNQEK---KDEAEVKFKEIKEAYEIL 58 Query: 284 ADERKRAAYD 255 +D++KRAAYD Sbjct: 59 SDDQKRAAYD 68 >ref|XP_003646186.1| hypothetical protein Ecym_4306 [Eremothecium cymbalariae DBVPG#7215] gi|356889821|gb|AET39369.1| hypothetical protein Ecym_4306 [Eremothecium cymbalariae DBVPG#7215] Length = 434 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y LG++ NA +E+ L L+YHPDK I +Q+ + +KE + A DIL+DE+K Sbjct: 6 YSVLGIKSNATEQEVKRAYRNLALMYHPDK-ISDESQRAESEAKFKEISAAYDILSDEQK 64 Query: 269 RAAYDH 252 R+ YDH Sbjct: 65 RSEYDH 70 >ref|WP_019025721.1| molecular chaperone DnaJ [Colwellia piezophila] Length = 378 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/70 (41%), Positives = 45/70 (64%) Frame = -3 Query: 464 SQKCWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDIL 285 S++ +Y+TLGV Q+A +KE+ K+ + YHPD+T ++E +KE A +IL Sbjct: 2 SKRDYYETLGVGQDATVKEVKKAYKKMAMKYHPDRTQGDKVKEE----TFKEVKEAYEIL 57 Query: 284 ADERKRAAYD 255 D++KRAAYD Sbjct: 58 NDDQKRAAYD 67 >gb|EKD55343.1| hypothetical protein ACD_60C00014G0017 [uncultured bacterium] Length = 369 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/66 (42%), Positives = 42/66 (63%) Frame = -3 Query: 452 WYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADER 273 +Y+TLGV ++A+ EI +L + YHPD+T H +E+ +KE A ++L+D R Sbjct: 6 YYETLGVSRSASEDEIKKAFRRLAMKYHPDRTNHDKASEEK----FKEAREAYEVLSDAR 61 Query: 272 KRAAYD 255 KRAAYD Sbjct: 62 KRAAYD 67 >gb|ESW12234.1| hypothetical protein PHAVU_008G095600g [Phaseolus vulgaris] Length = 586 Score = 57.4 bits (137), Expect = 3e-06 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGV++NA+ +EI KL L YHPDK KS Q++ + + NNA +IL+DE K Sbjct: 32 YKVLGVDKNASQREIQKAFHKLSLQYHPDKNKAKSAQEK-----FSQINNAYEILSDEEK 86 Query: 269 RAAYD 255 R YD Sbjct: 87 RKKYD 91 >ref|XP_004302542.1| PREDICTED: putative protein disulfide-isomerase DDB_G0275025-like [Fragaria vesca subsp. vesca] Length = 567 Score = 57.4 bits (137), Expect = 3e-06 Identities = 31/65 (47%), Positives = 40/65 (61%) Frame = -3 Query: 449 YQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDILADERK 270 Y+ LGVE+NA+ +EI KL L YHPDK K Q++ + E NNA +IL+DE K Sbjct: 29 YKVLGVEKNASQREIQKAFHKLSLKYHPDKNKAKGAQEK-----FAEINNAYEILSDEEK 83 Query: 269 RAAYD 255 R YD Sbjct: 84 RKNYD 88 >ref|WP_009767016.1| chaperone protein DnaJ [Moraxella macacae] gi|429541168|gb|ELA09196.1| chaperone protein DnaJ [Moraxella macacae 0408225] Length = 384 Score = 57.4 bits (137), Expect = 3e-06 Identities = 28/72 (38%), Positives = 48/72 (66%) Frame = -3 Query: 464 SQKCWYQTLGVEQNANLKEITSKAIKLMLLYHPDKTIHKSTQKERLDVNYKECNNAKDIL 285 S++ +Y LGV++NAN +EI KL + YHPD ++++ + + +KE + A ++L Sbjct: 2 SKRDFYAVLGVDKNANEQEIKKAYRKLAMKYHPD----RNSEDPQAEEKFKEASLAYEVL 57 Query: 284 ADERKRAAYDHV 249 +DE+KRAAYD + Sbjct: 58 SDEKKRAAYDRM 69