BLASTX nr result
ID: Ephedra26_contig00024970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ephedra26_contig00024970 (975 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004513005.1| PREDICTED: probable plastidic glucose transp... 60 1e-06 ref|XP_003620627.1| Sugar transporter [Medicago truncatula] gi|3... 57 4e-06 >ref|XP_004513005.1| PREDICTED: probable plastidic glucose transporter 2-like isoform X1 [Cicer arietinum] gi|502163972|ref|XP_004513006.1| PREDICTED: probable plastidic glucose transporter 2-like isoform X2 [Cicer arietinum] Length = 489 Score = 60.5 bits (145), Expect = 1e-06 Identities = 35/84 (41%), Positives = 45/84 (53%), Gaps = 10/84 (11%) Frame = +3 Query: 753 FIADCSLFGILGVLFIGIQIKYIS**WRAYF*IAGIPVALMVLDMELYVENPKWLVKQ-- 926 FI + FG+LG LFIGI +K IS WR F ++ IP AL+ L M E+P WL KQ Sbjct: 181 FIQIATCFGLLGALFIGIPVKEISGWWRVCFWVSNIPAALLALAMFFCAESPHWLFKQGR 240 Query: 927 --------SKLLNMSMKDFGIQQM 974 +LL +S F I Q+ Sbjct: 241 ITEAEAEFERLLGVSEAKFAISQL 264 >ref|XP_003620627.1| Sugar transporter [Medicago truncatula] gi|355495642|gb|AES76845.1| Sugar transporter [Medicago truncatula] Length = 490 Score = 57.0 bits (136), Expect(2) = 4e-06 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 10/83 (12%) Frame = +3 Query: 756 IADCSLFGILGVLFIGIQIKYIS**WRAYF*IAGIPVALMVLDMELYVENPKWLVKQ--- 926 IA C FGILG LFIGI +K IS WR F ++ IP A++ L M E+P WL KQ Sbjct: 185 IATC--FGILGSLFIGIPVKEISGWWRVCFWVSTIPAAILALAMVFCAESPHWLYKQGRT 242 Query: 927 -------SKLLNMSMKDFGIQQM 974 +LL +S F + Q+ Sbjct: 243 AEAEAEFERLLGVSEAKFAMSQL 265 Score = 21.2 bits (43), Expect(2) = 4e-06 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 701 LNVTEISSAHVRGHMEAL 754 L VTE+S A VRG AL Sbjct: 165 LYVTEVSPAFVRGTYGAL 182